Cancer Research Grants  Advances in Breast Cancer Research
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Jäger, D.
Right arrow Articles by Chen, Y.-T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Jäger, D.
Right arrow Articles by Chen, Y.-T.
[Cancer Research 61, 2055-2061, March 1, 2001]
© 2001 American Association for Cancer Research


Immunology

Identification of a Tissue-specific Putative Transcription Factor in Breast Tissue by Serological Screening of a Breast Cancer Library1

Dirk Jäger, Elisabeth Stockert, Ali O. Güre, Matthew J. Scanlan, Julia Karbach, Elke Jäger, Alexander Knuth, Lloyd J. Old and Yao-Tseng Chen2

Weill Medical College of Cornell University, New York, New York 10021 [D. J., Y-T. C.]; Medizinische Klinik, Hämatologie-Onkologie, Krankenhaus Nordwest, 60488 Frankfurt, Germany [J. K., E. J., A. K.]; and Ludwig Institute for Cancer Research, New York Branch, Memorial Sloan-Kettering Cancer Center, New York, New York 10021 [E. S., A. O. G., M. J. S., L. J. O., Y-T. C.]


    ABSTRACT
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Application of SEREX (serological analysis of recombinant tumor cDNA expression libraries) to different tumor types has led to the identification of several categories of human tumor antigens. In this study, the analysis of a breast cancer library with autologous patient serum led to the isolation of seven genes, designated NY-BR-1 through NY-BR-7. NY-BR-1, representing 6 of 14 clones isolated, showed tissue-restricted mRNA expression in breast and testis but not in 13 other normal tissues tested. Among tumor specimens, NY-BR-1 mRNA expression was found in 21 of 25 breast cancers but in only 2 of 82 nonmammary tumors. Structural analysis of NY-BR-1 cDNA and the corresponding genomic sequences in the recently released working draft of human genome indicated that NY-BR-1 is composed of 37 exons and has an open reading frame of 4.0–4.2 kb, encoding a peptide of Mr 150,000–160,000. A bipartite nuclear localization signal motif indicates a nuclear site for NY-BR-1, and the presence of a bZIP site (DNA-binding site followed by leucine zipper motif) suggests that NY-BR-1 is a transcription factor. Additional structural features include five tandem ankyrin repeats, implying a role for NY-BR-1 in protein-protein interactions. NY-BR-1 thus represents a breast tissue-specific putative transcription factor with autoimmunogenicity in breast cancer patients. In addition to NY-BR-1, a homologous gene, NY-BR-1.1, was identified in this study. NY-BR-1.1 shares 54% amino acid homology with NY-BR-1 and also shows tissue-restricted mRNA expression. However, unlike NY-BR-1, NY-BR-1.1 mRNA is expressed in brain, in addition to breast and testis. The exon structure of NY-BR-1.1 remains to be defined. Using human genome database, NY-BR-1 was localized to chromosome 10p11–p12, and NY-BR-1.1 was tentatively localized to chromosome 9.


    INTRODUCTION
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Whether immunological factors play a role in the development, growth, and progression of human breast cancer remains a critical unresolved issue. The lymphocyte infiltrates frequently associated with breast cancer (1, 2, 3, 4, 5) , particularly the intense T- and B-cell infiltrates in medullary carcinoma (6, 7, 8) , and the reactive changes in the draining lymph nodes of breast cancer patients (9 , 10) are consistent with the idea of immune recognition in breast cancer. However, efforts to relate the lymphocyte infiltrate and lymph node changes with prognosis have not yielded conclusive evidence for such an association (11) . The search for breast cancer antigens that elicit humoral or cellular immune reactions in breast cancer patients also has a long history, from evidence for immune responses against the murine mammary tumor virus (12) and delayed hypersensitivity and humoral immunity against T/Tn antigens (13) , to more recent findings of antibody and T-cell responses to p53 (14) and HER-2/neu (15 , 16) .

One major challenge confronting the analysis of autologous immune responses in breast cancer, however, is the well-recognized difficulty of establishing breast cancer cell lines as targets for immunological analysis. This is in contrast to the relative ease of establishing lines from melanoma, renal cancer, and other tumor types. For this reason, the analysis of the human T-cell response against melanoma and the molecular identification of the antigens eliciting these responses are far more advanced in melanoma (17, 18, 19) than in breast cancer.

The recent development of SEREX,3 a general method to analyze the humoral immune response of cancer patients that does not require autologous tumor cell lines, provides a powerful new way to dissect the immune response to breast cancer. Our initial application of SEREX to breast cancer led to the identification of p33ING1, encoded by a putative tumor suppressor gene in breast cancer, as an immunogenic breast cancer antigen. In addition, CT antigens, shown previously to be immunogenic antigens in other tumor types, were identified (20) . In the present study, we have continued our effort to define breast cancer antigens by SEREX. Of the panel of antigens identified, a highly restricted breast autoimmunogenic differentiation antigen, NY-BR-1, was identified and characterized.


    MATERIALS AND METHODS
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Tumor Tissue and Cell Lines.
The BR17 tumor sample was derived from a s.c. metastasis of a 60-year-old female patient at Krankenhaus Nordwest. The patient had an unusually favorable history with metastatic ductal carcinoma of the breast. Breast cancer cell lines and cell lines of other tumor types were obtained from the repository maintained at the Ludwig Institute for Cancer Research, New York Branch at the Memorial Sloan-Kettering Cancer Center. Tumor tissues were obtained from the Departments of Pathology at The New York Presbyterian Hospital and the Memorial Sloan-Kettering Cancer Center.

RNA Extraction and Construction of cDNA Expression Library.
Total RNA was extracted from the BR17 breast cancer sample by conventional CsCl-guanidine thiocyanate gradient method. A cDNA library was constructed in a {lambda}-ZAP Express vector, using a commercial cDNA library kit (Stratagene).

Immunoscreening of the cDNA Library.
The unamplified cDNA expression library was screened with the autologous serum at 1:200 dilution. The screening procedure was as described previously (21) . Briefly, the serum was diluted 1:10, preabsorbed with phage-transfected Escherichia coli lysate, further diluted to 1:200, and incubated overnight at room temperature with the nitrocellulose membranes (Schleicher & Schuell) containing the phage plaques at a density of 4000–5000 pfu/130-mm plate. After washing, the filters were incubated with alkaline phosphatase-conjugated goat antihuman Fc{gamma} secondary antibodies, and the reactive phage plaques were visualized by incubating with 5-bromo-4-chloro-3-indolyl-phosphate and nitroblue tetrazolium.

Sequence Analysis of the Reactive Clones.
The reactive clones were subcloned, purified, and in vivo excised to pBK-CMV plasmid forms (Stratagene). Plasmid DNA was prepared by using the Wizard Miniprep DNA Purification System (Promega). The inserted DNA was evaluated by EcoRI-XbaI restriction mapping, and clones representing different cDNA inserts were sequenced. The sequencing reactions were performed by the DNA Sequencing Service at Cornell University (Ithaca, NY) using Applied Biosystems PRISM (Perkin-Elmer) automated sequencers. DNA and amino acid sequences were compared with sequences in the GenBank and the EST databases using the BLAST program. Genes identical to entries in the GenBank were classified as known genes, whereas those that shared sequence identity only to ESTs and those which have no identity in either GenBank or EST databases were designated as unknown genes.

RT-PCR.
To evaluate the mRNA expression pattern of the cloned cDNA in normal and malignant tissues, total RNA was extracted from breast cancer cell lines and tumor specimens by the conventional CsCl-guanidine thiocyanate gradient method, and normal tissue RNA was obtained commercially (Clontech). Gene-specific oligonucleotide primers were designed to amplify cDNA segments of 300–600 bp in length, with the estimated primer melting temperature in the range of 65–70°C (see Figs. 2Citation and 4Citation for specific primer sequences). All primers were synthesized commercially (Operon Technologies, Alameda, CA). RT-PCR was performed using 30 amplification cycles in a thermal cycler (Perkin-Elmer) at an annealing temperature of 60°C, and the products were analyzed by 1.5% gel electrophoresis and ethidium bromide visualization.



View larger version (64K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 2. NY-BR-1 mRNA expression by RT-PCR. Primers used were: 5' primer BR1A, 5'-CAAAGCAGAGCCTCCCGAGAAG-3'; and 3' primer BR1B, and 5'-CCTATGCTGCTCTTCGATTCTTCC-3'. Of 15 normal tissues, RT-PCR showed strong signals in mammary gland and in testis, a very faint signal in placenta, and was negative in other tissues (a). Of 19 breast cancer specimens shown, 15 were positive, including three weak positives (breast tumors 3, 4, and 5; b).

 


View larger version (30K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 4. NY-BR-1.1 mRNA expression by RT-PCR. Primers used were: 5' primer BR-1.1A, 5'-TCTCATAGATGCTGGTGCTGATC-3'; and 3' primer BR1.1B, and 5'-CCCAGACATTGAATTTTGGCAGAC-3'. Of six normal tissues tested, RT-PCR showed a strong signal in testis, moderate signals in brain and mammary gland, and negative in kidney, liver, and colon (a). Of 10 breast cancer specimens, 8 were positive for NY-BR-1.1 (b). Comparing the NY-BR-1 and NY-BR-1.1 expression, 7 of 10 cotyped (6 positive and 1 negative), whereas two were positive for NY-BR-1.1 only (tumors 7 and 9), and one was positive for NY-BR-1 only (tumor 5).

 
Rapid Amplification of cDNA Ends.
RACE reactions (5'-RACE and 3'-RACE) were performed using gene-specific and adaptor-specific primers in conjunction with Marathon-Ready normal testis cDNA and AmpliTaq Gold polymerase (Perkin-Elmer). Products were ligated into the PCR-direct cloning vector pGEMT plasmid and analyzed by restriction mapping and sequencing.

Hybridization Screening of a Testicular Library.
A commercially obtained testis cDNA expression library (Stratagene) was screened using a NY-BR-1 PCR product as a probe (see Fig. 2Citation for primer sequences), as described in the Stratagene manual. Briefly, a total of 5 x 104 pfu/150-mm plate were transferred to nitrocellulose membranes (Schleicher & Schuell), the membranes were submerged in denaturation solution (1.5 M NaCl and 0.5 M NaOH) for 5 min, transferred into neutralization solution (1.5 M NaCl and 0.5 M Tris-HCl) for 5 min, and then rinsed in 0.2 M Tris-HCl and 2x SSC. The membranes were hybridized to a 32P-labeled DNA probe at high stringency condition (68°C, aqueous buffer) and washed at high stringency condition. Positive clones were subcloned, purified, and in vivo excised to pBK-CMV plasmid forms as described above.


    RESULTS
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
A total of 7 x 105 pfu from the BR17 cDNA library were screened using autologous BR17 serum at 1:200 dilution. Fourteen reactive clones were purified and sequenced. Comparison to GenBank and EST database revealed that these 14 clones were derived from seven distinct genes, two known and five unknown. These genes, designated NY-BR-1 through NY-BR-7, are described in Table 1Citation . Four clones were derived from the two known genes, PBK-1 (BR17-76, BR17-118, and BR17-137) and TI-227 (BR17-100). PBK-1 and TI-227 are universally expressed genes, because ESTs derived from these two genes have been reported in many different normal tissues. Of the remaining clones, NY-BR-4 through NY-BR-7, represented by one clone each, were also universally expressed based on comparison to EST databank entries. The six remaining clones, BR17-1a, BR17-8, BR17-35b, BR17-44a, BR17-44b, and BR17-128, were derived from the same unknown gene, NY-BR-1. Three matching cDNA sequences for NY-BR-1 were found in the EST database, two derived from breast cancer (accession numbers AI951118 and AW373574), and the third (accession number AW170035) derived from a pooled tissue source (testis, fetal lung, and B cell), suggesting a possible tissue-restricted expression of NY-BR-1 mRNA (see below).


View this table:
[in this window]
[in a new window]

 
Table 1 Clones identified by autologous SEREX screening of BR17 cDNA library

 
Structural Analysis of NY-BR-1 cDNA.
Compilation of the six NY-BR-1 cDNA clones revealed a cDNA sequence of 1464 bp. Analysis showed a continuous ORF throughout this sequence, indicating that this is a partial cDNA sequence, truncated at both 5' and 3' ends. Comparison with the EST entry AW170035 (446 bp) revealed 100% sequence identity in the 89 bp overlapping the 5' sequence, with the EST entry extending 357 bp further in its 3' sequence than NY-BR-1 cDNA clones. Sequences of the other two EST entries (AI951118 and AW373574) are contained within NY-BR-1. Combining the EST sequence with the cloned NY-BR-1 sequence allowed the definition of the translational termination codon, with a 3' untranslated region of 333 bp.

To complete the missing 5' cDNA sequence, a testicular library was screened using a NY-BR-1 PCR product as a probe. One of the clones isolated during this screening extended the 5' sequence of NY-BR-1 1346 bp but did not provide a definite translation initiation site. On the basis of this cDNA sequence, a 5' RACE-PCR was performed, and the PCR product was cloned into the pGEMT plasmid vector and sequenced. This 5'-RACE sequence extended the cDNA sequence 1292 bp further 5', with the longest ORF starting at the ATG codon at position 100. No stop codon was found in the 99-bp 5' sequence, suggesting the possibility of additional 5' coding sequence in NY-BR-1. However, repeated 5'-RACE using different nested-primer pairs and adaptor-ligated cDNA derived from different NY-BR-1 mRNA-positive tissues (testis and breast, see below) failed to extend the 5' cDNA sequence further.

The available NY-BR-1 cDNA has a 4125-bp coding sequence and a 333-bp 3'-untranslated segment (submitted to GenBank, accession number AF269087). The predicted amino acid sequence from the possible ATG initiation codon (nucleotide position 100) is shown in Fig. 1Citation . Motif analysis of the amino acid sequence using PROSITE and Pfam search programs identified a bipartite nuclear localization signal motif at amino acid position 17–34, suggesting that NY-BR-1 is a nuclear protein. Five tandem ankyrin repeats were also identified, located at amino acid positions 49–81, 82–114, 115–147, 148–180, and 181–213. The presence of a bZIP site (DNA-binding site followed by leucine zipper motif) at amino acid position 1077–1104 suggests that this nuclear protein functions as a transcription factor. Of interest, three additional repetitive elements were identified located between the ankyrin repeats and the NH2-terminal bZIP DNA-binding site (Fig. 1)Citation . The first repetitive element, consisting of 357 nucleotides (119 amino acids), is tandemly repeated three times, spanning amino acid residues 459–815. The second repetitive sequence, consisting of repeats of 11 amino acids, is located between amino acids 224 and 300 (seven repeats). The third repetitive sequence, consisting of only two repeats of 34 amino acids each, is located between amino acids 301–334 (Fig. 1)Citation .



View larger version (90K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 1. Predicted amino acid sequence of NY-BR-1. A bipartite nuclear localization signal motif is highlighted at amino acid positions 17–34. Five tandem ankyrin repeats are located at positions 49–81, 82–114, 115–147, 148–180, and 181–213. A bZIP (DNA-binding site followed by a leucine zipper motif) is located at position 1077–1104. The peptide segment present only in one of the two splice variants, positions 973-1009, is underlined. Three additional repetitive elements were identified (amino acids 459–815, 224–300, and 301–334; see text).

 
mRNA Expression of NY-BR-1.
NY-BR-1 mRNA expression was tested in a panel of 15 different normal tissues (adrenal gland, fetal brain, lung, mammary gland, pancreas, placenta, prostate, thymus, uterus, ovary, brain, kidney, liver, colon, and testis). RT-PCR analysis showed a strong signal in mammary gland and testis and a very faint signal in placenta. All other tissues were negative (Fig. 2A)Citation .

NY-BR-1 expression in breast cancers and other tumors was examined. Twenty-five breast cancer samples were tested, and 21 of them (84%) were positive by RT-PCR (17 showed strong signals, and the other 4 samples showed weak to moderate signals; part of the data are shown in Fig. 2BCitation ). Among 82 nonmammary tumor samples tested (36 melanomas, 26 non-small cell lung cancers, 6 colon cancers, 6 squamous cell carcinomas, 6 transitional cell carcinomas, and 2 leiomyosarcomas), only 2 melanomas showed NY-BR-1 expression.

The expression of NY-BR-1 in tissue culture lines was also examined in cell lines derived from breast tumor, melanoma, and small cell lung cancer. Four of six breast cancer cell lines (two showed very weak signals), four of eight melanoma lines (2 very weak), and 7 of 14 small cell lung cancer lines (2 very weak) were positive (data not shown).

Chromosomal Localization and Exon-Intron Organization of NY-BR-1.
Comparison of the NY-BR-1 sequences with the newly available working draft version of the human genome allowed the assignment of NY-BR-1 to chromosome 10p11.21–12.1, with at least three chromosome 10 clones showing sequence identity to NY-BR-1 (GenBank accession numbers AL157387, AL357148, and AC067744).

A comparison of NY-BR-1 cDNA and genomic sequences also permitted the definition of NY-BR-1 exon-intron organization. The amino acid coding region of this gene contains a basic framework of 19 structurally distinct exons, with at least two additional exons encoding 3'-untranslated sequence. The detailed exon-intron junction information is described in the GenBank entry (accession number AF269087). The six ankyrin repeats are encoded by exons 2–6. Of great interest was the finding that the 357-nucleotide repeating unit in NY-BR-1 cDNA is composed of six exons, exons 10–15. The available genomic sequences are incomplete in this region, and only one of the three copies of the 357-bp repeats in NY-BR-1 cDNA was identified. This finding suggests that the DNA segment between exons 10 and 15 were duplicated and inserted in tandem during evolution. In the isolated NY-BR-1 cDNA clones, three complete copies and one incomplete copy of such repeating units are present. Thus, the predicted exon sequences in NY-BR-1 can be expressed as exons 1–15-(10A-15A)-(10B-15B)-(10C-13C)-16–21, in which A, B, and C are inexact copies of the exon 10–15 sequences. The NY-BR-1 cDNA, therefore, is derived from a total of 37 exons; whether there are allelic differences in the copy number of this repetitive element (and thus the number of exons) in different individuals is currently unknown.

The available genomic sequence (GenBank AC067744) also allowed us to extend the 5' sequence of this gene beyond the cloned NY-BR-1 cDNA. Translation of the 5' genomic sequence using the previously assigned NY-BR-1 ORF led to the identification of a new translation initiation site 168 bp upstream to the previously predicted ATG initiation codon in NY-BR-1 cDNA (see text above and Fig. 1Citation ). If this newly identified ATG is the true initiation site used in vivo, the NY-BR-1 polypeptide would contain 1397 amino acids, 56 residues longer than is depicted in Fig. 1Citation (additional NH2 terminus sequence: MEEISAAAVKVVPGPERPSPFSQLVYTSNDSYIVHSGDLRKIHKAASRGQVRKLEK).

Identification of NY-BR-1 Splice Variants.
Sequence comparison of the six SEREX-defined NY-BR-1 clones revealed that they were derived from two different splice variants. One variant contains an additional coding sequence of 111 bp (nucleotide nos. 3015–3125 of cloned NY-BR-1 cDNA, encoding amino acids 973-1009; see Fig. 1Citation ), which is absent in the other variant. Comparison with the genomic sequence confirmed that this results from an alternate splicing event, with the longer variant incorporating part of the intron 33 into exon 34 (i.e., exon 17 of the basic exon-intron framework described above). Key structural elements predicted above in the NY-BR-1 sequence are present in both splice variants, suggesting no apparent difference in biological function or subcellular localization.

The expression of these two splice variants was evaluated using primers specific to the larger variant, as well as primers spanning the alternatively spliced exon. In the normal tissues analyzed, both variants showed strong expression in testis and breast by RT-PCR (but not in other tissues), with the larger variant being the dominant form in testis and the shorter variant dominant in breast. A selective group of 10 breast cancer samples were typed for these two splice forms, and results showed cotyping of the two variants (7 strong positive, 2 weaker positive, and 1 negative), with the shorter variant consistently being the predominant form.

Isolation of a NY-BR-1 Homologue Gene.
Screening testicular cDNA library with a NY-BR-1 probe identified a cDNA encoding a new gene with homology to the NY-BR-1 gene. This clone, 3673 bp excluding the poly(A) tail, corresponded to nucleotides 1–3481 of the NY-BR-1 and showed 62% homology. A DNA database search revealed no sequence identity to GenBank "nr" database, and the new gene has been designated NY-BR-1.1 (submitted to GenBank, accession number AF269088). ORF analysis showed an ORF from nucleotide 641 to the end of the cloned sequence, with 54% homology to the putative NY-BR-1 protein sequence. The ATG initiation codon of NY-BR-1.1 is preceded by a 640-bp 5'-untranslated region with scattered stop codons. Comparison of the available NY-BR-1 and NY-BR-1.1 amino acid sequences is shown in Fig. 3Citation . RT-PCR analysis for NY-BR-1.1 showed a tissue-restricted mRNA expression pattern distinct from NY-BR-1. Among six normal tissues examined, NY-BR-1.1 showed strong RT-PCR signal in testis, moderate signals in brain and breast tissues, and was negative in kidney, liver, and colon (Fig. 4A)Citation . Upon multiple repeated experiments, normal breast tissues showed either no or weak signals, consistently weaker than those observed in testis and often in brain, indicating a lower level of expression. NY-BR-1.1 expression was also examined in six breast cancer cell lines and 10 breast cancer specimens. One of six breast cancer cell lines was positive, in contrast to four of six for NY-BR-1. Eight of 10 breast cancer specimens were positive. In comparison with NY-BR-1 expression, 6 were positive for both, 1 was positive for NY-BR-1 only, 2 were positive for NY-BR-1.1 only, and 1 was negative for both (Fig. 4B)Citation . The strong expression in brain and low-level expression in normal breast and the lack of correlation in NY-BR-1 and NY-BR-1.1 expression in breast cancer lines and tissues indicate that these two gene products have a clearly distinct expression pattern.



View larger version (45K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 3. Comparison of the predicted amino acid sequences of NY-BR-1 and NY-BR-1.1. Identical sequences are shown as dots (····), and gaps are shown as dashes (----).

 
Genomic Sequence of NY-BR-1.1.
Comparison of the NY-BR-1.1 sequence with the released working draft of the human genome revealed one clone with sequence identity (GenBank AL359312). This clone was presumably derived from chromosome 9, indicating that NY-BR-1 and NY-BR-1.1 reside on two different chromosomes. The AL359312 genomic sequence does not contain the entire NY-BR-1.1 cDNA sequence, precluding the definition of NY-BR-1.1 exon-intron structure. However, at least three exons can be defined, which are the counterparts of the basic framework of exons 16, 17, and 18 in NY-BR-1. The exon-intron junctions of NY-BR-1 and NY-BR-1.1 are conserved in these exons.


    DISCUSSION
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
The SEREX approach has proved to be a very powerful tool to identify tumor antigens (20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30) . SEREX-defined antigens have been classified into several categories, including differentiation antigens, CT antigens, mutational antigens, amplified/overexpressed antigens, splice variant antigens, and retroviral antigens (31) . The expression of NY-BR-1 in breast tissue and testis but not in other normal tissues indicates that NY-BR-1 belongs to the category of differentiation antigens.

Differentiation antigens are antigens that show expression in specific cell lineage(s) or at specific stages of differentiation in a particular cell lineage(s) (32) . This category of antigens has been best studied in cells of lymphoid and hematopoietic derivation, starting with the definition of mouse cell surface differentiation antigens of lymphocytes, such as TL (33 , 34) , Thy-1 (35) , and Lyt-2 (36) . Application of hybridoma technology to the analysis of human cells resulted in the identification of a broad range of differentiation antigens, and this has led to the classification system for CD antigens (37) . Most of the initial CD antigens were restricted differentiation antigens expressed in lymphocytes and other hematopoietic cells, e.g., CD1 through CD8 primarily restricted to T cells (38) . The expression of differentiation antigens in normal cells is generally preserved in their neoplastic counterparts, and this feature has made these antigens useful markers in the immunopathological differential diagnosis of cancer. The best example of this is again in the hematopoietic/lymphocytic lineages, in which the antigenic profile of the neoplastic cells provided the foundation for the classification of leukemia/lymphoma (39) . In addition, these antigens can be targets for specific immunotherapy, and anti-CD20 antibody, recognizing a B-cell differentiation antigen, represents the first monoclonal antibody approved by the Food and Drug Administration for cancer immunotherapy (40) .

In addition to cells of hematopoietic origin, the melanocyte, a specialized cell type in the neuroectodermal lineage, has been found to express a number of well-characterized differentiation antigens, most of them associated with the melanin-synthesis pathway. Studies using polyclonal and monoclonal antibodies initially defined tyrosinase (41) , gp75 (42) , and gp100 (43) . Recent efforts to identify melanoma antigens recognized by CD8+ and CD4+ T cells also identified these antigens as T-cell targets and further expanded the list of melanocyte differentiation antigens (44, 45, 46, 47, 48) . Melan-A/MART-1, identified by transfection-based T-cell epitope cloning as a CD8+ T-cell target (48 , 49) , and Rab38 (50) , identified by SEREX analysis of melanoma, are two further examples of melanocyte differentiation antigens identified through these efforts. Similar to their hematopoietic counterparts, the melanocyte differentiation antigens have also been found useful in the clinical arena. Antibodies against gp100 and Melan-A/MART-1 are widely used to distinguish metastatic melanomas from other metastatic malignancies (51) , and melanoma vaccine trials targeting these antigens are being actively pursued (see Ref. 52 for an example).

With regard to common epithelial tissue, a wide range of gene products with differential expression have been defined, e.g., cytokeratins (53 , 54) , mucin-related antigens (55) , and hormonal receptors (56) . However, with rare exceptions, none of these are exclusively expressed in only a single epithelial cell type, such as breast epithelium. In this regard, NY-BR-1 is of considerable interest because of its highly restricted expression pattern in normal tissue, i.e., breast and testis. The production of antibody probes for NY-BR-1 is essential to confirm breast specificity at the protein and cell levels. With regard to cancer vaccine development, the restricted expression of NY-BR-1 in normal breast and breast cancer makes it a highly attractive vaccine target. However, the presence of a homologous gene, NY-BR-1.1, that is expressed in brain is cause for concern, and it will be necessary to show that T-cell reactivity to NY-BR-1 can be generated without cross-recognition of NY-BR-1.1.

The predicted protein sequence of NY-BR-1 contains a DNA-binding site and a leucine zipper motif (bZIP). The bZIP motif characterizes the superfamily of eucaryotic DNA-binding transcription factors that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper required for dimerization (57 , 58) . It is thus most likely that NY-BR-1 is a transcription factor. Five ankyrin repeats are also present in the NY-BR-1 protein. Ankyrin repeat proteins carry out a wide variety of biological activities and are found in both cytoplasm and nucleus. The repeat motif has been recognized in >400 proteins, including cyclin-dependent kinase inhibitors, transcriptional regulators, cytoskeletal organizers, developmental regulators, and toxins (59) . Thus, the ankyrin repeat in itself is not predictive of a specific cellular function or subcellular localization; rather, ankyrin repeats are thought to mediate a wide range of protein-protein interactions (59) . In comparison to other ankyrin repeat-containing proteins, NY-BR-1 is unique because of the other repetitive elements in its predicted protein sequence. These additional repetitive elements are not found in other sequences in the public protein databases, and their functional significance remains to be determined.

By comparing the cDNA sequence with the recently released working draft of the human genome, we were able to derive the following important information about NY-BR-1: (a) confirming the cDNA sequences of NY-BR-1 and NY-BR-1.1; (b) mapping to chromosome 10p11–12 and NY-BR-1.1tentatively to chromosome 9; (c) definition of the exon-intron structure of NY-BR-1, a complex gene with 37 exons, and correlate exon structure to repeating peptide units; and (d) completion of the NH2 terminus amino acid sequence of NY-BR-1 that had defied our multiple cloning efforts and RACE analysis. On the other hand, the cDNA sequences of NY-BR-1 and NY-BR-1.1 genes from this study will certainly help the annotation of corresponding genome sequences. The current study thus provides a clear example of valuable data that can be achieved by interaction between the human genome project and other scientific fields.


    FOOTNOTES
 
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

1 Supported by NIH Grant CA-68024 and by the Cancer Research Institute/Rhea (Rose Marie) Finnell Memorial Fellowship for breast cancer research. Back

2 To whom requests for reprints should be addressed, at Department of Pathology, Weill Medical College, Cornell University, 1300 York Avenue, New York, NY 10021. E-mail: ytchen{at}med.cornell.edu Back

3 The abbreviations used are: SEREX, serological analysis of recombinant tumor cDNA expression libraries; CT, cancer testis; EST, expressed sequence tag; RT-PCR, reverse transcription-PCR; RACE, rapid amplification of cDNA ends; ORF, open reading frame; CD, cluster of differentiation; pfu, plaque-forming unit. Back

Received 8/25/00. Accepted 12/28/00.


    REFERENCES
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 

  1. Shimokawara I., Imamura M., Yamanaka N., Ishii Y., Kikuchi K. Identification of lymphocyte subpopulations in human breast cancer tissue and its significance: an immunoperoxidase study with antihuman T- and B-cell sera. Cancer (Phila.), 49: 1456-1464, 1982.[Medline]
  2. Giorno R. Mononuclear cells in malignant and benign human breast tissue. Arch. Pathol. Lab. Med., 107: 415-417, 1983.[Medline]
  3. Bhan A. K., DesMarais C. L. Immunohistologic characterization of major histocompatibility antigens and inflammatory cellular infiltrate in human breast cancer. J. Natl. Cancer Inst., 71: 507-516, 1983.
  4. Hurlimann J., Saraga P. Mononuclear cells infiltrating human mammary carcinomas: immunohistochemical analysis with monoclonal antibodies. Int. J. Cancer, 35: 753-762, 1985.[Medline]
  5. Gottlinger H. G., Rieber P., Gokel J. M., Lohe K. J., Riethmuller G. Infiltrating mononuclear cells in human breast carcinoma: predominance of T4+ monocytic cells in the tumor stroma. Int. J. Cancer, 35: 199-205, 1985.[Medline]
  6. Ben-Ezra J., Sheibani K. Antigenic phenotype of the lymphocytic component of medullary carcinoma of the breast. Cancer (Phila.), 59: 2037-2041, 1987.[Medline]
  7. Gaffey M. J., Frierson H. F., Jr., Mills S. E., Boyd J. C., Zarbo R. J., Simpson J. F., Gross L. K., Weiss L. M. Medullary carcinoma of the breast. Mod. Pathol., 6: 721-728, 1993.[Medline]
  8. Hsu S. M., Raine L., Nayak R. N. Medullary carcinoma of breast: an immunohistochemical study of its lymphoid stroma. Cancer (Phila.), 48: 1368-1376, 1981.[Medline]
  9. Hirschl S., Black M. M., Kwon C. S. Ultrastructural characteristics of sinus histiocytic reaction in lymph nodes draining various stages of breast cancer. Cancer (Phila.), 38: 807-817, 1976.[Medline]
  10. Black M. M., Barclay T. H., Hankey B. F. Prognosis in breast cancer utilizing histologic characteristics of the primary tumor. Cancer (Phila.), 36: 2048-2055, 1975.[Medline]
  11. Fisher E. R., Costantino J., Fisher B., Redmond C. Pathologic findings from the National Surgical Adjuvant Breast Project (Protocol 4). Cancer (Phila.), 71: 2141-2150, 1993.[Medline]
  12. Black M. M., Zachrau R. E., Shore B., Moore D. H., Leis H. P., Jr. Prognostically favorable immunogens of human breast cancer tissue: antigenic similarity to murine mammary tumor virus. Cancer (Phila.), 35: 121-128, 1975.[Medline]
  13. Springer G. F. Immunoreactive T and Tn epitopes in cancer diagnosis, prognosis, and immunotherapy. J. Mol. Med., 75: 594-602, 1997.[Medline]
  14. Gnjatic S., Cai Z., Viguier M., Chouaib S., Guillet J. G., Choppin J. Accumulation of the p53 protein allows recognition by human CTL of a wild-type p53 epitope presented by breast carcinomas and melanomas. J. Immunol., 160: 328-333, 1998.[Abstract/Free Full Text]
  15. Disis M. L., Calenoff E., McLaughlin G., Murphy A. E., Chen W., Groner B., Jeschke M., Lydon N., McGlynn E., Livingston R. B., et al Existent T-cell and antibody immunity to HER-2/neu protein in patients with breast cancer. Cancer Res., 54: 16-20, 1994.[Abstract/Free Full Text]
  16. Disis M. L., Cheever M. A. HER-2/neu protein: a target for antigen-specific immunotherapy of human cancer. Adv. Cancer Res., 71: 343-371, 1997.[Medline]
  17. Oettgen H. F., Livingston P. O., Old L. J. Immunotherapy by active specific immunization DeVita S. H. V. Rosenberg S. A. eds. . Biologic Therapy of Cancer, 1: 682-701, J. B. Lippincott Co. Philadelphia 1991.
  18. Boon T., van der Bruggen P. Human tumor antigens recognized by T lymphocytes. J. Exp. Med., 183: 725-729, 1996.[Free Full Text]
  19. Kawakami Y., Rosenberg S. A. Human tumor antigens recognized by T-cells. Immunol. Res., 16: 313-339, 1997.[Medline]
  20. Jager D., Stockert E., Scanlan M. J., Gure A. O., Jager E., Knuth A., Old L. J., Chen Y. T. Cancer-testis antigens and ING1 tumor suppressor gene product are breast cancer antigens: characterization of tissue-specific ING1 transcripts and a homologue gene. Cancer Res., 59: 6197-6204, 1999.[Abstract/Free Full Text]
  21. Chen Y. T., Scanlan M. J., Sahin U., Tureci O., Gure A. O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L. J. A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening. Proc. Natl. Acad. Sci. USA, 94: 1914-1918, 1997.[Abstract/Free Full Text]
  22. Jager E., Chen Y. T., Drijfhout J. W., Karbach J., Ringhoffer M., Jager D., Arand M., Wada H., Noguchi Y., Stockert E., Old L. J., Knuth A. Simultaneous humoral and cellular immune response against cancer-testis antigen NY-ESO-1: definition of human histocompatibility leukocyte antigen (HLA)-A2-binding peptide epitopes. J. Exp. Med., 187: 265-270, 1998.[Abstract/Free Full Text]
  23. Sahin U., Tureci O., Schmitt H., Cochlovius B., Johannes T., Schmits R., Stenner F., Luo G., Schobert I., Pfreundschuh M. Human neoplasms elicit multiple specific immune responses in the autologous host. Proc. Natl. Acad. Sci. USA, 92: 11810-11813, 1995.[Abstract/Free Full Text]
  24. Tureci O., Sahin U., Zwick C., Koslowski M., Seitz G., Pfreundschuh M. Identification of a meiosis-specific protein as a member of the class of cancer/testis antigens. Proc. Natl. Acad. Sci. USA, 95: 5211-5216, 1998.[Abstract/Free Full Text]
  25. Gure A. O., Tureci O., Sahin U., Tsang S., Scanlan M. J., Jager E., Knuth A., Pfreundschuh M., Old L. J., Chen Y. T. SSX: a multigene family with several members transcribed in normal testis and human cancer. Int. J. Cancer, 72: 965-971, 1997.[Medline]
  26. Gure A. O., Altorki N. K., Stockert E., Scanlan M. J., Old L. J., Chen Y. T. Human lung cancer antigens recognized by autologous antibodies: definition of a novel cDNA derived from the tumor suppressor gene locus on chromosome 3p21.3. Cancer Res., 58: 1034-1041, 1998.[Abstract/Free Full Text]
  27. Scanlan M. J., Chen Y. T., Williamson B., Gure A. O., Stockert E., Gordan J. D., Tureci O., Sahin U., Pfreundschuh M., Old L. J. Characterization of human colon cancer antigens recognized by autologous antibodies. Int. J. Cancer, 76: 652-658, 1998.[Medline]
  28. Chen Y. T., Gure A. O., Tsang S., Stockert E., Jager E., Knuth A., Old L. J. Identification of multiple cancer/testis antigens by allogeneic antibody screening of a melanoma cell line library. Proc. Natl. Acad. Sci. USA, 95: 6919-6923, 1998.[Abstract/Free Full Text]
  29. Tureci O., Sahin U., Pfreundschuh M. Serological analysis of human tumor antigens: molecular definition and implications. Mol. Med. Today, 3: 342-349, 1997.[Medline]
  30. Brass N., Heckel D., Sahin U., Pfreundschuh M., Sybrecht G. W., Meese E. Translation initiation factor eIF-4{gamma} is encoded by an amplified gene and induces an immune response in squamous cell lung carcinoma. Hum. Mol. Genet., 6: 33-39, 1997.[Abstract/Free Full Text]
  31. Old L. J., Chen Y. T. New paths in human cancer serology. J. Exp. Med., 187: 1163-1167, 1998.[Free Full Text]
  32. Rettig W. J., Old L. J. Immunogenetics of human cell surface differentiation. Annu. Rev. Immunol., 7: 481-511, 1989.[Medline]
  33. Schlesinger M., Hurvitz D. Differentiation of the thymus-leukemia (TL) antigen in the thymus of mouse embryos. Isr. J. Med. Sci., 4: 1210-1215, 1968.[Medline]
  34. Old L. J. Cancer immunology: the search for specificity–G. H. A. Clowes Memorial lecture. Cancer Res., 41: 361-375, 1981.[Abstract/Free Full Text]
  35. Shiku H., Kisielow P., Bean M. A., Takahashi T., Boyse E. A., Oettgen H. F., Old L. J. Expression of T-cell differentiation antigens on effector cells in cell-mediated cytotoxicity in vitro. J. Exp. Med., 141: 227-241, 1975.[Abstract/Free Full Text]
  36. Cantor H., Boyse E. A. Functional subclasses of T-lymphocytes bearing different Ly antigens. J. Exp. Med., 141: 1376-1389, 1975.[Abstract/Free Full Text]
  37. Bernard A., Boumsell L., Hill C. Joint report of the First International Workshop on Human Leukocyte Differentiation Antigens by the investigators of the participating laboratories Berenard A. Boumsell L. Dausset J. Milstein C. Schlossman S. F. eds. . Leukocyte Typing: Human Leukocyte Differentiation Antigens Selected by Monoclonal Antibodies, : 9-142, Springer-Verlag New York 1984.
  38. Knapp W. Dorken B. Gilks W. R. Rieber E. P. Schmidt R. E. Stein H. von dem Borne A. E. G. Kr. eds. . Leukocyte Typing IV, : 229-386, Oxford University Press New York 1989.
  39. Nathwani B. N., Brynes R. K., Lincoln T., Taylor C. R., Hansemann M. L. Classification of the non-Hodgkin’s lymphomas Knowles D. M. eds. . Neoplastic Hematopathology, : 555-602, Williams and Wilkins Baltimore 1992.
  40. Grillo-Lopez A. J., White C. A., Varns C., Shen D., Wei A., McClure A., Dallaire B. K. Overview of the clinical development of rituximab: first monoclonal antibody approved for the treatment of lymphoma. Semin. Oncol., 26: 66-73, 1999.[Medline]
  41. Jimenez M., Tsukamoto K., Hearing V. J. Tyrosinases from two different loci are expressed by normal and by transformed melanocytes. J. Biol. Chem., 266: 1147-1156, 1991.[Abstract/Free Full Text]
  42. Mattes M. J., Thomson T. M., Old L. J., Lloyd K. O. A pigmentation-associated, differentiation antigen of human melanoma defined by a precipitating antibody in human serum. Int. J. Cancer, 32: 717-721, 1983.[Medline]
  43. Gown A. M., Vogel A. M., Hoak D., Gough F., McNutt M. A. Monoclonal antibodies specific for melanocytic tumors distinguish subpopulations of melanocytes. Am. J. Pathol., 123: 195-203, 1986.[Abstract]
  44. Brichard V., Van Pel A., Wolfel T., Wolfel C., De Plaen E., Lethe B., Coulie P., Boon T. The tyrosinase gene codes for an antigen recognized by autologous cytolytic T lymphocytes on HLA-A2 melanomas. J. Exp. Med., 178: 489-495, 1993.[Abstract/Free Full Text]
  45. Wang R. F., Robbins P. F., Kawakami Y., Kang X. Q., Rosenberg S. A. Identification of a gene encoding a melanoma tumor antigen recognized by HLA-A31-restricted tumor-infiltrating lymphocytes[published erratum appears in J. Exp. Med., 181: 1261, 1995]. J. Exp. Med., 181: 799-804, 1995.[Abstract/Free Full Text]
  46. Wang R. F., Appella E., Kawakami Y., Kang X., Rosenberg S. A. Identification of TRP-2 as a human tumor antigen recognized by cytotoxic T lymphocytes. J. Exp. Med., 184: 2207-2216, 1996.[Abstract/Free Full Text]
  47. Coulie P. G., Brichard V., Van Pel A., Wolfel T., Schneider J., Traversari C., Mattei S., De Plaen E., Lurquin C., Szikora J. P., Renauld J-C., Boon T. A new gene coding for a differentiation antigen recognized by autologous cytolytic T lymphocytes on HLA-A2 melanomas. J. Exp. Med., 180: 35-42, 1994.[Abstract/Free Full Text]
  48. Kawakami Y., Eliyahu S., Delgado C. H., Robbins P. F., Rivoltini L., Topalian S. L., Miki T., Rosenberg S. A. Cloning of the gene coding for a shared human melanoma antigen recognized by autologous T cells infiltrating into tumor. Proc. Natl. Acad. Sci. USA, 91: 3515-3519, 1994.[Abstract/Free Full Text]
  49. Van den Eynde B. J., van der Bruggen P. T cell defined tumor antigens. Curr. Opin. Immunol., 9: 684-693, 1997.[Medline]
  50. Jäger D., Stockert E., Jäger E., Güre A., Scanlan M. J., Knuth A., Old L. J., Chen Y-T. Serological cloning of a melanocyte rab guanosine 5'-triphosphate-binding protein and a chromosome condensation protein from a melanoma complementary DNA library. Cancer Res., 60: 3584-3591, 2000.[Abstract/Free Full Text]
  51. Jungbluth A. A., Busam K. J., Gerald W. L., Stockert E., Coplan K. A., Iversen K., MacGregor D. P., Old L. J., Chen Y. T. A103: an antimelanoma monoclonal antibody for the detection of malignant melanoma in paraffin-embedded tissues. Am. J. Surg. Pathol., 22: 595-602, 1998.[Medline]
  52. Rosenberg S. A., Yang J. C., Schwartzentruber D. J., Hwu P., Marincola F. M., Topalian S. L., Restifo N. P., Dudley M. E., Schwarz S. L., Spiess P. J., Wunderlich J. R., Parkhurst M. R., Kawakami Y., Seipp C. A., Einhorn J. H., White D. E. Immunologic and therapeutic evaluation of a synthetic peptide vaccine for the treatment of patients with metastatic melanoma. Nat. Med., 4: 321-327, 1998.[Medline]
  53. Fuchs E., Tyner A. L., Giudice G. J., Marchuk D., Raychaudhury A., Rosenberg M. The human keratin genes and their differential expression. Curr. Top. Dev. Biol., 22: 5-34, 1987.[Medline]
  54. Moll R. Cytokeratins in the histological diagnosis of malignant tumors. Int. J. Biol. Markers, 9: 63-69, 1994.[Medline]
  55. Denton G., Sekowski M., Spencer D. I., Hughes O. D., Murray A., Denley H., Tendler S. J., Price M. R. Production and characterization of a recombinant anti-MUC1 scFv reactive with human carcinomas. Br. J. Cancer, 76: 614-621, 1997.[Medline]
  56. Ferguson A. T., Lapidus R. G., Davidson N. E. The regulation of estrogen receptor expression and function in human breast cancer. Cancer Treat. Res., 94: 255-278, 1998.[Medline]
  57. Hurst H. C. Transcription factors 1: bZIP proteins. Protein Profile, 2: 101-168, 1995.[Medline]
  58. Ellenberger T., Fass D., Arnaud M., Harrison S. C. Crystal structure of transcription factor E47: E-box recognition by a basic region helix-loop-helix dimer. Genes Dev., 8: 970-980, 1994.[Abstract/Free Full Text]
  59. Sedgwick S. G., Smerdon S. J. The ankyrin repeat: a diversity of interactions on a common structural framework. Trends Biochem. Sci., 24: 311-316, 1999.[Medline]



This article has been cited by other articles:


Home page
Endocr Relat CancerHome page
M. Lacroix
Significance, detection and markers of disseminated breast cancer cells
Endocr. Relat. Cancer, December 1, 2006; 13(4): 1033 - 1067.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
R. B. Parmigiani, F. Bettoni, M. D. Vibranovski, M. H. Lopes, W. K. Martins, I. W. Cunha, F. A. Soares, A. J. G. Simpson, S. J. de Souza, and A. A. Camargo
Characterization of a cancer/testis (CT) antigen gene family capable of eliciting humoral response in cancer patients
PNAS, November 28, 2006; 103(48): 18066 - 18071.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
W. Wang, J. Epler, L. G. Salazar, and S. R. Riddell
Recognition of Breast Cancer Cells by CD8+ Cytotoxic T-Cell Clones Specific for NY-BR-1.
Cancer Res., July 1, 2006; 66(13): 6826 - 6833.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
Z. Varga, J.-P. Theurillat, V. Filonenko, B. Sasse, B. Odermatt, A. A. Jungbluth, Y.-T. Chen, L. J. Old, A. Knuth, D. Jager, et al.
Preferential Nuclear and Cytoplasmic NY-BR-1 Protein Expression in Primary Breast Cancer and Lymph Node Metastases.
Clin. Cancer Res., May 1, 2006; 12(9): 2745 - 2751.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
M. Chatterjee, S. Mohapatra, A. Ionan, G. Bawa, R. Ali-Fehmi, X. Wang, J. Nowak, B. Ye, F. A. Nahhas, K. Lu, et al.
Diagnostic Markers of Ovarian Cancer by High-Throughput Antigen Cloning and Detection on Arrays
Cancer Res., January 15, 2006; 66(2): 1181 - 1190.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Respir. Crit. Care Med.Home page
L. Zhong, G. E. Hidalgo, A. J. Stromberg, N. H. Khattar, J. R. Jett, and E. A. Hirschowitz
Using Protein Microarray as a Diagnostic Assay for Non-Small Cell Lung Cancer
Am. J. Respir. Crit. Care Med., November 15, 2005; 172(10): 1308 - 1314.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
L. Radvanyi, D. Singh-Sandhu, S. Gallichan, C. Lovitt, A. Pedyczak, G. Mallo, K. Gish, K. Kwok, W. Hanna, J. Zubovits, et al.
The gene associated with trichorhinophalangeal syndrome in humans is overexpressed in breast cancer
PNAS, August 2, 2005; 102(31): 11005 - 11010.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
F. Fernandez-Madrid, N. Tang, H. Alansari, J. L. Granda, L. Tait, K. C. Amirikia, M. Moroianu, X. Wang, and R. L. Karvonen
Autoantibodies to Annexin XI-A and Other Autoantigens in the Diagnosis of Breast Cancer
Cancer Res., August 1, 2004; 64(15): 5089 - 5096.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
S.-Y. Lee, Y. Obata, M. Yoshida, E. Stockert, B. Williamson, A. A. Jungbluth, Y.-T. Chen, L. J. Old, and M. J. Scanlan
Immunomic analysis of human sarcoma
PNAS, March 4, 2003; 100(5): 2651 - 2656.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
A. M. Krackhardt, M. Witzens, S. Harig, F. S. Hodi, A. J. Zauls, M. Chessia, P. Barrett, and J. G. Gribben
Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX
Blood, August 28, 2002; 100(6): 2123 - 2131.
[Abstract] [Full Text] [PDF]


Home page
Clin. Chem.Home page
B. K. Zehentner, D. C. Dillon, Y. Jiang, J. Xu, A. Bennington, D. A. Molesh, X. Zhang, S. G. Reed, D. Persing, and R. L. Houghton
Application of a Multigene Reverse Transcription-PCR Assay for Detection of Mammaglobin and Complementary Transcribed Genes in Breast Cancer Lymph Nodes
Clin. Chem., August 1, 2002; 48(8): 1225 - 1231.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
M. J. Scanlan, S. Welt, C. M. Gordon, Y.-T. Chen, A. O. Gure, E. Stockert, A. A. Jungbluth, G. Ritter, D. Jager, E. Jager, et al.
Cancer-related Serological Recognition of Human Colon Cancer: Identification of Potential Diagnostic and Immunotherapeutic Targets
Cancer Res., July 15, 2002; 62(14): 4041 - 4047.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Jäger, D.
Right arrow Articles by Chen, Y.-T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Jäger, D.
Right arrow Articles by Chen, Y.-T.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online