Cancer Research Targets  EMT and Cancer Progression and Treatment
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.
[Cancer Research 62, 6187-6193, November 1, 2002]
© 2002 American Association for Cancer Research


Immunology

Antitumor Efficacy of Wild-Type p53-specific CD4+ T-Helper Cells1

Sander Zwaveling2, Michel P. M. Vierboom2, Sandra C. Ferreira Mota, Jennifer A. Hendriks, Marlies E. Ooms, Roger P. M. Sutmuller, Kees L. M. C. Franken, Hans W. Nijman, Ferry Ossendorp, Sjoerd H. van der Burg, Rienk Offringa and Cornelis J. M. Melief3

Departments of Immunohematology and Blood Transfusion [S. Z., M. P. M. V., S. C. F. M., J. A. H., M. E. O., R. P. M. S., K. L. M. C. F., H. W. N., F. O., S. H. v. d. B., R. O., C. J. M. M.] and Surgery [S. Z.], Leiden University Medical Center, 2333 ZA Leiden, the Netherlands


    ABSTRACT
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Overexpression of p53 is found in ~50% of human cancers, making it an attractive target antigen for immunotherapy of cancer. Research in this area has thus far primarily focused on p53-specific CTLs. Although these CTLs were shown to be highly effective against p53-overexpressing tumors in vivo, immunological tolerance seems to strongly restrict the spectrum of the p53-specific CTL repertoire in p53+/+ subjects. In view of the emerging role of CD4+ Th (Th) cells in the antitumor response, we investigated the specificity and antitumor efficacy of the p53-specific Th response in mice. Our data show that high affinity Th cells against the naturally processed epitope p53108–122 can be elicited in both p53-/- and p53+/+ mice, indicating that the p53-specific T-cell response is not affected by tolerance at the Th level. Furthermore, p53108–122-specific Th cells were effective in enabling p53-specific CTLs to control the growth of p53-overexpressing tumors in vivo. Therefore, exploitation of the p53-specific Th response appears to be a highly useful aspect of immunotherapeutic strategies against cancers.


    INTRODUCTION
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Mutations in the gene encoding the tumor suppressor protein p53 are found in ~50% of all human malignancies (1) . The aberrant expression of p53 in a wide variety of tumors, mainly caused by mutations in the p53 gene, and its direct involvement in the malignant transformation of those tumors make it an attractive target for immunotherapy. Studies aiming at evaluating p53 as a target for immunotherapy were mainly focused on the identification of p53-derived MHC class I presented peptides, which are recognized by CD8+ CTLs (2, 3, 4, 5, 6) . In several studies p53-specific vaccination in p53+/+ mice was shown to induce protective immunity against a subsequent challenge with p53 overexpressing tumors (3 , 7, 8, 9) . Although this antitumor effect was attributed to the presence of p53-specific CTLs, in only one of these studies limited evidence was provided to support the notion that CTLs were actually involved (3) . Recent experiments demonstrated that in p53+/+ mice a considerable degree of tolerance for p53 exists at the CTL level and that only low avidity CTLs can be found against p53 in the periphery (10, 11, 12) . Several efforts to raise the CTL response, using CTLA-4 blockade or CD40 activation, did result in higher cell numbers, but not in higher avidity (10 , 13) . These data suggest that immunization strategies exclusively aiming at induction of the CD8+ arm of the p53-specific T-cell response are unlikely to result in effective antitumor immunity.

Numerous studies show that anti-p53 IgG antibodies can be found in the serum of cancer patients (14, 15, 16, 17, 18, 19, 20, 21, 22) . Because isotype switching from IgM to IgG antibodies is Th4 cell dependent, this demonstrates a role for CD4+ cells in inducing p53-specific responses (23) . Moreover, as opposed to CTLs, these findings indicate that tolerance against wt.p53 is incomplete at the level of antibodies and CD4+ cells. Recent literature underscores the importance of CD4+ cells as regulators of the antitumor immune response (24, 25, 26, 27) . Several studies demonstrate that Th cells display a unique ability to orchestrate an immunological attack by mobilizing multiple effector arms of the immune system. One such an effector mechanism of CD4+ cells, following specific recognition of antigen presented on APCs in the context of MHC class II, involves the induction of CTL responses by activating the APC through CD40-CD40-ligand interaction (28, 29, 30) . Other recent findings demonstrate the specific nature of T-cell help in the eradication of MHC class II negative tumors (24) . This encompasses not only the induction of CTL via cross-priming, but also the recruitment of MHC nonrestricted effector cells with tumoricidal activities, such as eosinophils and macrophages (25) .

In this study we identified four murine wt.p53-derived peptides against which specific Th responses could be elicited after vaccination of p53-/- mice. Th cells against one of these peptides, p53108–122 (LGFLQSGTAKSVMCT), not only recognized peptide loaded DCs, but also p53 protein loaded DCs, arguing that these T cells recognized a naturally processed epitope. The antitumor efficacy of the p53108–122-specific Th cells, as well as the fact that such Th cells can also be elicited in normal p53+/+ mice, point at the potential of p53-specific Th immunity for immunotherapy of cancer.


    MATERIALS AND METHODS
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Mice.
C57BL/6 (B6, H-2b) and BALB/c (H-2d) mice were obtained from IFFA Credo (Paris, France). C57BL/6 nu/nu mice were purchased from Bomholtgard (Ry, Denmark). MHC class II knockout mice (MHC class II-/-; H-2b) were obtained from Taconic. The p53 knockout mice (p53-/-; H-2b) were bred at TNO (Leiden, Netherlands) but were originally obtained from GenPharm (Mountain View, CA) and held under specific pathogen-free conditions. Because offspring could only be obtained by crossing p53 heterozygous females (p53+/-) with p53 knockout males (p53-/-), the mice had to be analyzed for their p53 status by PCR analysis. For the PCR analysis two primer sets were used. Primer set A consists of a forward primer binding to the neomycin resistance gene (5' GCA TCG CCT TCT ATC GCC TTC TTG AC 3', neo fwd), with which the wt.p53 gene was destroyed, and a reverse primer, which binds to a sequence in exon 5 (5' ATC ACC ATC GGA GCA GCG CTC ATG 3', p53 exon 5 rev.). Primer set A yields a band of 120 bp only when the neomycine gene is present. Primer set B consists of a forward primer binding to a sequence in intron 4 of the wt.p53 gene (5' CAG TCC TCT CTT TGC TGG CTC GCT CT 3', p53 intron 4 fwd), which is deleted by the insertion of the neomycine resistance gene in the wt.p53 gene. This sequence is only present in an intact wt.p53 gene. The same reverse primer used in primer set A was used for primer set B. Primer set B gives a band of 324 bp only when the wt.p53 gene is present.

Peptides.
Wt.p53 peptides were generated as described before (31) . The purity of the peptides was determined by reverse-phase high-performance liquid chromatography and was found to be routinely >90% pure. Mass spectrometry analysis (Lasermat, Finnigan MAT, United Kingdom) showed that their molecular masses were within 0.1% of the calculated values. Peptides were dissolved in 0.5% DMSO in PBS and, if not used immediately, stored at -20°C. The nomenclature concerning the p53-derived peptides refers to the numbers of the first and last amino acid. The peptides p53153–171 (RVRAMAIYKKSQHMTEVVR) and p53119–134 (VMCTYSPPLNKLFCQL) were selected because they contain putative CTL epitopes (Table 1B)Citation . The peptide p53108–122 (LGFLQSGTAKSVMCT) and peptide p53135–150 (AKTCPVQLWVSATPPA) were selected on the basis of the presence of an I-Ab motif sequence (Table 1A)Citation . The peptide p53100–131 (YQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLF) is a wt.p53-derived 32-mer containing p53108–122 with its natural flanking sequences. The wt.p53-derived 32-mer-peptide p53146–167 was used as a negative control. Peptide env-H19 (EPLTSLTPRCNTAWNRLKL; amino acid120–138) is the immunodominant helper epitope from the R-MuLV env-gp70 protein and was used as a control peptide (24) .


View this table:
[in this window]
[in a new window]

 
Table 1 Selection of candidate wt.p53-derived Th epitopes that could serve as targets for CD4+ Th cells in C57BL/6 mice

 
Proteins.
Recombinant wt.p53 murine protein and reverse transcriptase protein were produced in Escherichia coli and purified as described before (32) . Baculovirus-derived wt.p53 murine protein was obtained from Virogenetics (Troy, NY).

Immunization Strategies.
p53-/- and C57BL/6 male mice were used for s.c. immunization. The two peptides containing potential CTL epitopes were administered at a dose of 60 µg dissolved in PBS and emulsified in 50% IFA. Mice were boosted after 2 weeks with the same dose. The MHC class II I-Ab motif-bearing peptides were administered in mixes of three peptides at a final dose of 60 µg/peptide/mouse emulsified in 50% IFA. Mice were boosted after 2 weeks with identical mixtures.

T-Cell Cultures.
CD4+ T cells were obtained from immunized mice by culturing spleen cells (2.5 x 106 cells/well of a 24-well plate) in the presence of 5–10 µg/ml peptide or protein in complete medium. Complete medium consists of Iscove’s Modified Dulbecco’s Medium (BioWhittaker, Walkersville, MD) supplemented with 8% FCS, 100 IU/ml penicillin, 2 mM glutamine (ICN, Costa Mesa, CA), and 30 µM 2- mercaptoethanol (Merck, Darmstadt, Germany). Cultures were maintained at 37°C in humidified air containing 5% CO2. No exogenous IL-2 was added. On day 4 dead cells were removed from the culture by centrifugation over a Ficoll density gradient and seeded in 24-well plates at 1 x 106 cells/well together with 30 IU IL-2/ml (Chiron BV, Amsterdam, the Netherlands). On day 7 the T-cell cultures were stimulated with 1 x 106 irradiated B6 spleen cells/well in the presence of 5–10 µg/ml peptide or protein. The responding cells were Ficolled again on day 11 and seeded in 24-well plates at 0.5 x 106 cells/well in the presence of 30 IU IL-2/ml. Established Th lines and clones were cultured at 1 x 105 cells/well and stimulated as described above.

Cell Lines and Antibodies.
MECs of C57BL/6 origin (B6MEC) were transformed by transfection with the oncogenes mut.p53 + H-ras (tumor cell line 4J) as described previously (33) . The tumor cell line 4J expresses high levels of mutant p53 as determined by immunoprecipitation and cytospin (34) . The p53-/- MEC cell line is a MEC line obtained from p53-/- mice and does not express p53. 3A12 is a Th clone specific for the env-H19 peptide derived from the R-MuLV envelope protein (24) . 1H11 is a wt.p53-specific CTL line (35) obtained from p53-/- mice. 9.5 is a HPV16 E7-specific CTL line. D1 cells are long-term growth factor-dependent immature splenic DCs derived from C57BL/6 (H-2b) mice and were cultured as described (36 , 37) . Before use, D1 cells were incubated for 48 h with peptides, protein, or tumor cell lysates. Subsequently, D1 cells were activated by adding lipopolysaccharide (10 µg/ml) for 6 h and then thoroughly washed and irradiated. Tumor cell lysates were prepared by three freeze/thaw cycles of cell suspension (1 x 106 cells/ml) in complete medium. The equivalent of 2.5 x 106 cells was added to the D1 cultures. The p53-specific IgG2b antibody pAb 122 was added to cell lysates at a concentration of 10 µg/ml. APC-labeled antimouse CD8a (LY-2; 53–6.7), APC-labeled antimouse CD4 Ab (L3T4; clone RM4–5) and FITC-labeled antimouse CD3e Ab (CD3{epsilon} chain; 145–2c11) were used for FACS analysis.

Proliferation Assay.
Responder cells were seeded at a concentration of 2 x 104 cells/well (T-cell cultures) or 1 x 104 cells/well (T-cell lines) in a 96-well U-bottomed plate. Irradiated C57BL/6 spleen cells were incubated with either peptide or protein (5–10 µg) and added as stimulator cells at a concentration 1 x 105 cells/well. Alternatively, irradiated and lipopolysaccharide-activated D1 cells were used as stimulators at a concentration of 1250 cells/well. No exogenous IL-2 was added. After 3 days at 37°C the cultures were pulsed with [3H]thymidine (NEN; 0.5 µCi/well); incubated for 18 h and then harvested. Thymidine incorporation was measured on a Beta-plate liquid scintillation counter (Wallac, Turku, Finland). Depicted in the figures are cpm.

Limiting Dilution.
Cells of specifically proliferating T-cell cultures were titered to concentrations of 100, 30, 10, 3, or 1 cells/well in complete medium. The cells were stimulated weekly with 5 x 104 irradiated spleen cells/well in the presence of 5–10 µg/ml peptide or protein and supplemented with 30 IU IL-2/ml. Proliferating clones were analyzed for antigen specificity.

Cytokine Assay.
Supernatant of specifically stimulated T-cell cultures was harvested after 3 days. Production of IFN-{gamma} by the T cells was measured by a sandwich ELISA performed in maxisorp plates (Nunc, Roskilde, Denmark) using antimouse-IFN-{gamma}-specific antibodies [clones R4–6A2 (capture) and biotinylated XMG1.2 (detection); PharMingen, San Diego, CA], streptavidin conjugated poly-horseradish peroxidase (CLB, Amsterdam, the Netherlands), and ABTS [2,2'-azino-bis(3-ethylbenzthiazoline)-6-sulfonic acid; Sigma, St. Louis, MO] as a substrate. Absorbance was measured at 415 nm using kineticalc 2.12 software in an EL312e Biokinetics ELISA plate reader (Biotek Instruments, Winooski, VT). The same protocol for measuring cytokines was used for IL-2 [clones JES6–1A12 (capture) and biotinylated JES6–5H4 (detection); PharMingen], IL-4 [clones 11B11 (capture) and biotinylated BVD6–24G2 (detection); PharMingen], and IL-10 [clones JES5–2A5 (capture) and biotinylated SXC-1 (detection); PharMingen].

Adoptive Transfer of Th Cells and CTL.
Female, nude T-cell-deficient C57BL/6 mice were challenged s.c. with 10 x 106 4J tumor cells. After 16 days the wt.p53-specific Th line D2.p53, wt.p53-specific CTL clone 1H11, and control Th line 3A12 were injected i.v. in various combinations at numbers of either 4 x 106 or 8 x 106 cells per mouse. If indicated, 6 x 105 IU rIL-2 were added s.c. in 50% IFA on the day of adoptive transfer and 7 days later.

FACS Analysis.
FACS analysis was performed as described elsewhere (31) with modifications.

Statistical Analysis.
The effect of the various therapies on measured tumor size in mice was statistically analyzed using the Mann-Whitney test.


    RESULTS
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Selection of Candidate wt.p53-derived Th Epitopes.
A panel of 11 wt p53-derived peptides that could serve as targets for CD4+ Th cells in C57BL/6 (B6) mice was selected on the basis of two distinct criteria. Nine peptides were selected after screening the wt.p53 sequence for peptides fitting the I-Ab motif (Table 1ACitation ; Refs. 38 , 39 ). Furthermore, two peptides were selected based on the notion that in other antigens sequences of natural CTL and Th epitopes were found to overlap. This phenomenon of epitope linkage was, among others, found for epitopes in the HPV16 E7 protein (31 , 40) , the HIV-1 envelope protein (41) , and the insulin-dependent diabetes mellitus-associated GAD65 protein (42) . A potential advantage of epitope linkage lies in the increased chance for simultaneous presentation of both the MHC class I and the class II-restricted epitopes on the surface of a single APC, thereby facilitating the delivery of cognate T-cell help to CTL priming (43) . Artificial linkage of physiologically nonoverlapping CTL and Th epitopes has proven to be advantageous as shown in studies with HIV and measles (43 , 44) . Peptide p53153–171 was generated by extending the known wt.p53-derived H-2Kb-restricted CTL epitope p53158–166 (AIYKKSQHM) with five amino acids at both ends with its natural flanking sequences (35) . Peptide p53119–134 was selected because it comprises 4 additional wt.p53-derived peptides that were reported previously to bind to either H-2Kb or H-2Db (35) . The immunogenicity of the set of 11 p53-derived peptides was examined by analyzing their capacity to induce peptide-specific proliferative responses. Initially, we vaccinated p53-/- mice to circumvent possible influences of p53-specific tolerance on the induction of peptide-specific immunity. The mice received two subsequent vaccinations with 60 µg of peptide, after which spleen cells were stimulated with the relevant peptide in vitro. After 2 weeks of in vitro stimulation the various T-cell cultures were tested for peptide-specific proliferation. Specific responses were obtained against 4 of the 11 peptides (Table 1Citation ; Fig. 1, A–DCitation ), whereas long-term T-cell cultures could be maintained for 3 peptides (Fig. 1, E–G)Citation . Notably, the long-term cultures showed increased peptide specificity as compared with the early T-cell cultures, which is conceivably because of the selection of peptide-specific T cells in the former cultures.



View larger version (17K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 1. Peptide-specific responses can be raised against four wt.p53-derived Th peptides. Spleen cell bulk cultures (after 14 days in vitro culture; A–D) and Th lines derived from these early cultures (E–G) were obtained from p53-/- mice after vaccination with various peptides. Specific proliferation was tested by measuring thymidine incorporation (in cpm). Specificity of both the bulk cultures and the Th lines was tested on nonpulsed spleen cells (<->), on spleen cells loaded with the various specific peptides and on spleen cells pulsed with a peptide derived from the envelope protein of the R-MuLV as a negative control (env-H19).

 
Identification of Peptide p53108–122 as a Naturally Processed p53 Th Epitope.
Many of the peptide-specific T-cell cultures failed to proliferate after stimulation with full-length p53 protein. However, one of the cultures raised against peptide p53108–122 (T-cell line D2.p53) was not only able to expand on stimulation with the peptide, but also on stimulation with the p53 protein and, therefore, we studied this T-cell line in more detail. FACS analysis confirmed that we had indeed generated a CD4+ Th line (Fig. 2A)Citation , whereas additional experiments demonstrated that the peptide-specific response was MHC class II restricted (Fig. 2B)Citation . Moreover, this Th line proved to be clonal as demonstrated by the unanimous expression of the Vß14 TCR chain on all of the cells using a Vß Screening Panel (PharMingen; data not shown). Th cultures capable of expanding in the presence of either protein or peptide antigen are likely to possess the capacity of recognizing physiological quantities of naturally processed epitope. To examine this, we compared the proliferative capacity of the p53108–122-specific Th line D2.p53 against APCs pulsed with the p53108–122 peptide, a longer 32-mer peptide (p53100–131) comprising this p53108–122 epitope, as well as a full-length p53 protein. The Th line responded strongly to either of the three antigen formulations, but not to the control peptides and control protein (Fig. 2C)Citation . Because the Th line did not respond to a control protein derived from the same expression system, but did react against recombinant p53 derived from a baculovirus expression system, the reactivity against p53 represented indeed true antigen-specific responsiveness. Importantly, although reactivity against APC pulsed with the 15-mer peptide p53108–122 is probably largely the result of recognition of peptides that have been loaded exogenously onto surface I-Ab molecules, reactivity against APC pulsed with either the 32-mer peptide and especially full-length p53 requires antigen uptake and processing by the APC. Therefore, our data indicate that peptide p53108–122, as recognized by Th line D2.p53, represents a naturally processed p53-derived Th epitope.



View larger version (16K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 2. The p53108–122-specific CD4+ MHC class II restricted Th line D2.p53 recognizes a naturally processed epitope. The T-cell line D2.p53 was double-stained with Abs directed against either CD4 and CD3 or against CD8 and CD3 and subsequently analyzed by FACS (A). The HPV16 E7-specific CTL clone 9.5 was taken along for comparison. The percentage of double-stained cells within the populations of both T-cell lines is indicated. Background of nonstained cell lines is not indicated, but did not exceed 2%. To confirm that the recognition of the p53108–122 peptide by D2.p53 was MHC class II restricted, spleen cells of syngeneic B6 mice, MHC mismatched BALB/c mice, or MHC matched but MHC class II-/- mice (H-2b) were pulsed with this peptide and incubated in the presence of D2.p53 (B). Supernatant was harvested and an IFN-{gamma} ELISA assay was performed. As a control, the Ovalbumine Th epitope (OVA) was taken along. D1 cells pulsed with p53-derived peptides or p53 protein are potent stimulators of Th line D2.p53. Specific proliferation was tested by measuring thymidine incorporation (in cpm; C). Specificity was tested on nonpulsed D1 cells (<->), on D1 cells pulsed with the specific peptide (p53108–122), and on D1 cells pulsed with a peptide derived from the envelope protein of the R-MuLV as a negative control (env-H19). Furthermore, specificity was tested on D1 cells pulsed with the 32-mer peptide containing p53108–122 (peptide p53100–131) and on D1 cells pulsed with a wt.p53 derived 32-mer peptide encompassing a different stretch (peptide p53146–167) as a negative control. Additionally, specificity was tested on D1 cells pulsed with p53 protein purified from E. coli (p53) and on D1 cells pulsed with the reverse transcriptase protein as a negative control (RT). Finally, specificity was tested on D1 cells pulsed with p53 protein purified from baculovirus-infected cells [p53 (b)].

 
As mentioned before, the p53-specific responses were observed in p53-/- mice. Interestingly, we noted similar peptide-specific responses against peptides p53153–171 and p53108–122 in vaccinated p53+/+ mice. As was the case in the p53-/- mice, the p53108–122-specific culture also showed reactivity against APC pulsed with the full-length p53 protein (Fig. 3A)Citation . A long-term Th line derived from one of these early cultures showed similar reactivity (Fig. 3B)Citation . The specific reactivity for p53 protein-pulsed APC was more pronounced for this established Th line, in line with the fact that this culture is more enriched for T cells of the relevant specificity. Our data thus demonstrate that Th cell immunity against the wt.p53-derived epitope p53108–122 can be induced in both p53-/- and p53+/+ mice. To further analyze these responses, we determined the sensitivity of the well-defined p53-/- Th clone D2.p53 to its antigen by comparing its capacity to recognize low amounts of peptide with a previously isolated Th clone specific for a peptide derived from a R-MuLV envelope protein (clone 3A12). This clone has been shown to assist CTLs in the eradication of highly aggressive R-MuLV induced RMA tumors.5 Th line D2.p53 responded against APCs loaded with peptide and protein antigen in the 2–5 nM range (Fig. 4, A and B)Citation , and thereby revealed a sensitivity which was even higher than that of the R-MuLV-specific clone (Fig. 4C)Citation . Therefore, we conclude that the affinity of Th line D2.p53 is sufficiently high to fulfill the requirements for mediating adequate antitumor responses.



View larger version (11K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 3. The I-Ab motif-bearing peptide p53108–122 can elicit Th responses against naturally processed p53 in p53+/+ mice. A 14-day spleen cell bulk culture (A) and a Th line derived from this early culture (B) were obtained from p53+/+ mice after vaccination. Specific proliferation was tested by measuring thymidine incorporation (in cpm). Specificity of both the bulk culture and the Th line was tested on nonpulsed spleen cells (<->), on spleen cells loaded with the specific peptide (p53108–122), and on spleen cells pulsed with a peptide derived from the envelope protein of the R-MuLV (env-H19) as a negative control. Furthermore, specificity was tested on spleen cells pulsed with the p53 protein (p53) and on spleen cells pulsed with the reverse transcriptase protein (RT) as a negative control.

 


View larger version (17K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 4. The wt.p53 Th line D2.p53 displays high affinity toward its epitope p53108–122. The affinity of the p53-specific Th clone D2.p53 was tested using spleen cells loaded with titered amounts of p53108–122 peptide (A) and spleen cells pulsed with titered amounts of p53 protein (B). The affinity of a Th clone specific for a peptide derived from a R-MuLV envelope protein (clone 3A12), known to assist MuLV-specific CTL in the eradication of RMA tumors, was taken along for comparison (C).

 
Functional Properties of p53108–122-specific Th Cells in Vitro.
Contribution of p53-specific Th cells to an effective antitumor immune response would require these cells to react against APCs that present tumor cell-derived antigen. To establish whether the p53108–122-specific Th line could recognize its epitope when supplied to APC by tumor cells, D1 DCs were incubated with tumor lysates from the murine p53 overexpressing tumor cell line 4J and subsequently used as stimulators for the Th cells. Indeed, the Th cells responded against APC pulsed with this tumor lysate, whereas no specific proliferation was observed when APCs were pulsed with lysate from p53-negative cells (Fig. 5A)Citation . Because the p53-overexpressing tumor cell line is MHC Class II negative, this recognition must involve cross-presentation by the D1 cells. Cross-presentation improved if the p53-specific IgG2b antibody pAb 122 was added to the lysate (Fig. 5A)Citation , consistent with previous reports by others, which indicated that antigens can be more efficiently presented by DCs through Fc receptor-mediated uptake than after fluid phase internalization (45, 46, 47) . Determination of the lymphokine profile of Th line D2.p53 revealed secretion of considerable levels of IFN-{gamma} on specific stimulation, whereas only limited amounts of IL-4 and no detectable levels of either IL-10 or IL-2 were found (Fig. 5B)Citation . Taken together, our data suggest that peptide p53108–122 represents a naturally processed epitope that can be derived, processed, and presented from p53-overexpressing tumor cells. The peptide p53108–122-specific clonal Th line D2.p53 is capable of recognizing physiological quantities of its cognate antigen and, when triggered by its antigen, displays a Th1 type lymphokine profile.



View larger version (19K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 5. The p53108–122-specific Th line D2.p53 recognizes p53-overexpressing tumor cells and displays a Th 1 type lymphokine profile. Specific recognition by Th line D2.p53 was tested on D1 cells, which were cultured in the presence of freeze/thaw lysates from either p53-/- MEC or from 4J, the p53-overexpressing MEC transfected with mutp53 + H-ras. Where indicated, the p53-specific IgG2b antibody pAb 122 (#122) was added to enhance uptake of p53 protein. Nonpulsed D1 cells (<->) and D1 cells pulsed with p53 protein were taken along as additional controls. A lymphokine profile of D2.p53 is shown in B. D2.p53 was added to p53 protein-pulsed spleen cells and left for 3 days. Supernatant was harvested, and various ELISA assays were performed. As a control, the lymphokine profile from unstimulated D2.p53 is depicted.

 
Antitumor Effect of Th Line D2.p53 in Vivo.
We and others have demonstrated that tumor-specific Th immunity plays an important role in the immune response against class II MHC-negative tumors (24 , 48) . In view of this notion, as well as the fact that the functional properties of Th line D2.p53 point at a desirable Th1-type phenotype (Fig. 5B)Citation , we analyzed whether D2.p53 can provide help to tumor-specific CTLs in vivo. We have shown previously that adoptively transferred CTLs directed against the wt.p53 peptide p53158–166 are highly effective in eradicating p53-overexpressing tumors in vivo, provided that the tumor-challenged mice also receive a s.c. depot of recombinant IL-2 (35) . We now tested whether coadministration of p53-specific Th cells could replace the need for exogenous IL-2. Previous experiments by our laboratory have shown that Th cells with a relevant antigen specificity can effectively assist adoptively transferred CTLs in eliminating Sendai virus infections and R-MuLV-expressing tumors (49) .5 Nude mice bearing palpable p53-overexpressing tumors received p53-specific CTLs (clone 1H11) in combination with either IL-2, p53-specific Th cells (line D2.p53) or R-MuLV-specific Th cells (clone 3A12). In accordance with data described previously (35) , p53-specific CTLs in combination with IL-2 resulted in complete tumor regression, whereas the CTL failed to eradicate the tumors in the absence of exogenous IL-2 (Fig. 6)Citation . Importantly, the p53-specific Th cells provided help to the CTLs, as opposed to the R-MuLV-specific Th cells, which recognize an antigen that is not expressed by the tumor concerned. The same R-MuLV-specific Th cells had clear cut antitumor activity against R-MuLV-induced RMA tumors.6 The capacity of Th line D2.p53 to provide antigen-specific help to the p53-specific CTL was equally clear in a second, independent experiment. This latter experiment also showed that administration of p53-specific Th cells alone, without the p53-specific CTL, did not have any effect on tumor growth, indicating that these Th cells exert their effect by providing help to the wt.p53-specific CTL (Fig. 7)Citation .



View larger version (19K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 6. Antitumor effect of Th line D2.p53 in vivo (n = 5). T cell-deficient nude mice bearing 16-day p53-overexpressing tumors (4J) were adoptively transferred using various strategies. Th cells were administered at a number of 4 x 106 cells per mouse and CTL at a number of 8 x 106 cells per mouse. The following transfer strategies were tested: wt.p53-specific Th line D2.p53 combined with the wt.p53-specific CTL 1H11 ({square}); the Rauscher-specific Th line 3A12 combined with the CTL ({triangleup}); the CTL with IL-2 ({circ}); the CTL alone ({blacksquare}); no treatment ({blacktriangleup}). The effect of IL-2 alone on the p53-overexpressing tumor cell line had been tested before and had no influence on tumor growth. The effect of the Rauscher-specific Th line 3A12 alone on tumor growth had also been studied before and was found to be absent. Because of extensive tumor load the mice in the control groups had to be killed after four weeks ({dagger}). Bars, ±SE. Statistical analysis was performed using the Mann-Whitney test, revealing that the groups receiving either the combination of the Th line D2.p53 and the CTL or receiving the combination of IL-2 and the CTL showed significant delay in tumor growth compared with the untreated mice, whereas the other groups did not (P < 0.05).

 


View larger version (18K):
[in this window]
[in a new window]
[Download PPT slide]
 
Fig. 7. Comparison of antitumor effect of the combination of D2.p53 and wtp53-specific CTL versus D2.p53 alone (n = 8). T cell-deficient nude mice bearing 16-day p53-overexpressing tumors (4J) were adoptively transferred using various strategies. In comparison to the experiment described in Fig. 6Citation the number of administered Th cells was doubled: both Ths and CTL were administered at an amount of 8 x 106 cells per mouse. The following transfer strategies were tested: wt.p53-specific Th line D2.p53 combined with the wt.p53-specific CTL 1H11 ({square}); D2.p53 alone ({triangleup}); the CTL with IL-2 ({circ}); the CTL alone ({blacksquare}); no treatment ({blacktriangleup}). Because of extensive tumor growth, mice had to be killed in the control groups after four weeks ({dagger}). Bars, ±SE. Statistical analysis was performed using the Mann-Whitney test, demonstrating that the groups receiving either the combination of the Th line D2.p53 and the CTL or receiving the combination of IL-2 and the CTL showed significant delay in tumor growth compared with the untreated mice, whereas the other groups did not (P < 0.05).

 
Whereas the combination of CTL and IL-2 resulted in complete eradication of the tumors, the combination of CTL and D2.p53 Th cells failed to induce full tumor regression (Figs. 6Citation and 7Citation ). Consequently mice treated with the latter combination, despite displaying prolonged survival, eventually developed progressive tumor growth. Raising the number of transferred Th cells did not increase the antitumor effect of the combination of D2.p53 and the CTL (Fig. 7)Citation . This is most likely related to the fact that the p53-specific Th line D2.p53, in contrast to previously studied Th clones against Sendai virus and R-MuLV (49) ,5 does not secrete measurable quantities of IL-2 on antigenic stimulation (Fig. 5B)Citation . The absence of antitumor activity by the Th line D2.p53 alone (Fig. 7)Citation may also be a result of this meager IL-2 secretion. However, in additional experiments no difference in tumor development was detected after treatment with either the Th clone D2.p53 alone or in combination with exogenously added IL-2 (data not shown).


    DISCUSSION
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Our present work demonstrates that IFN-{gamma}-producing Th cells recognizing the naturally processed epitope p53108–122 can be found in the repertoire of both p53-/- and p53+/+ mice. Moreover, we show here that a p53-/- derived wt.p53 Th line (D2.p53) can effectively assist p53-specific CTLs in delaying the growth of p53-overexpressing tumors in vivo.

The absence of immunological tolerance for the ubiquitously expressed wt p53 auto-antigen at the CD4+ Th level was predicted by the finding of natural IgG class anti-p53 antibodies and Th responses in cancer patients and tumor-bearing mice (14, 15, 16, 17, 18, 19, 20, 21, 22 , 50, 51, 52) . This stands in remarkable contrast to the considerable degree of tolerance for p53 at the CD8+ CTL level. Although some indications have been found for high affinity p53-specific CTLs in p53+/+ mice as well as in human subjects, only few studies provided direct evidence for such CTLs (3 , 5) , whereas other studies indicate that the p53-specific CTL repertoire in p53+/+ subjects is highly restricted (10, 11, 12) . In accordance with these latter studies, numerous attempts using a variety of vaccine formulations never resulted in the induction of detectable CTLs against the p53158–166 epitope in p53+/+ B6 mice, although these CTL were reproducibly found in appropriately immunized p53-/- mice (35) .7 In our opinion, this case of split-tolerance can be explained by taking into account the metabolism of wt p53. In normal somatic cells, this protein has a very high turnover, as it becomes rapidly degraded via the ubiquitin- and proteasome-dependent pathway (53) . It is highly conceivable that this degradation pathway efficiently feeds p53-derived peptides into the class I MHC presentation pathway, enabling normal somatic cells including thymic APCs to present these peptides at their surface. In contrast, the dominance of the proteasome-dependent degradation will not leave considerable amounts of p53 available for use by the class II MHC processing pathway. Furthermore, this prevents accumulation of wt p53 to steady-state levels that would suffice for cross-presentation by professional APCs. Taken together, these circumstances make it very unlikely that, in a healthy subject, p53-derived peptides are presented in the context of class II MHC, either in the thymus or in the periphery, thereby explaining the lack of tolerance at the Th level (54) . Indeed, as noted before, very similar Th lines against wt.p53 peptide p53108–122 were generated by us in both p53-/- and p53+/+ mice. However, it should be mentioned that no affinity tests were performed with the p53+/+-derived Th line, hampering a full comparison between the two cell lines. Therefore, the possibility that a limited level of tolerance is present at the Th level cannot be totally excluded.

The p53-/- D2.p53 Th cell line displayed clear in vivo antitumor activity when combined with the p53-specific CTL. Yet, no complete remission could be achieved, contrary to the combination of the CTL with exogenous IL-2. This may be because of the modest IL-2 production by the Th line, but this is difficult to prove. Furthermore, it is possible that other mechanisms, such as CD40-CD40L interactions of the Th cells with APC, also play a role.

Importantly, the use of p53-specific Th activity is not restricted to the combination with p53-specific CTL, used as a read-out in the current paper, because such Th cells will also be capable of providing "help" to CTL against other antigens expressed by the same tumor (24) . On the basis of this principle, we envisage immunotherapeutic approaches against colorectal cancer that use the combination of p53-specific T-cell help with CTL against other antigens expressed by this type of tumor such as carcinoembryonic antigen and epithelial cell adhesion molecule (55, 56, 57) . Because the key prerequisite for efficacy of p53-specific help in antitumor immunity, overexpression of p53, is found in ~50% of all human cancers, p53-specific Th responses appear to be a highly versatile tool for immunotherapy of cancer.


    ACKNOWLEDGMENTS
 
We thank Marcel Camps and Danita Schuurhuis for help with various experiments.


    FOOTNOTES
 
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

1 Supported by the Dutch Organization for Scientific Research (Grant 920-03-094) and by the Dutch Cancer Society (Grants 961352, 961354, 971449, and 971451). Back

2 These authors contributed equally to this work. Back

3 To whom requests for reprints should be addressed, at Department of Immunohematology and Blood Transfusion, Room L3-32, Leiden University Medical Center, Albinusdreef 2, 2333 ZA Leiden, The Netherlands. Phone: 31-71-5265129; Fax: 31-71-5216751; E-mail: cvdmeij{at}lumc.nl Back

4 The abbreviations used are: Th, T helper; APC, antigen-presenting cell; DC, dendritic cell; IFA, incomplete Freund’s adjuvant; IL, interleukin; MEC, mouse embryo cell; R-MuLV, Rauscher murine leukemia virus; Ab, antibody; FACS, fluorescence-activated cell sorter; cpm, counts per min; wt, wild-type. Back

5 F. Ossendorp, unpublished observations. Back

6 F. Ossendorp and C. J. M. Melief, unpublished observations. Back

7 S. Zwaveling and M. P. M. Vierboom, unpublished observations. Back

Received 5/ 8/02. Accepted 8/23/02.


    REFERENCES
 Top
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 

  1. Hollstein M., Sidransky D., Vogelstein B., Harris C. C. p53 mutations in human cancers. Science (Wash. DC), 253: 49-53, 1991.[Abstract/Free Full Text]
  2. Houbiers J. G., Nijman H. W., van der Burg S. H., Drijfhout J. W., Kenemans P., van de Velde C. J., Brand A., Momburg F., Kast W. M., Melief C. J. In vitro induction of human cytotoxic T lymphocyte responses against peptides of mutant and wild-type p53. Eur. J. Immunol., 23: 2072-2077, 1993.[Medline]
  3. Mayordomo J. I., Loftus D. J., Sakamoto H., De Cesare C. M., Appasamy P. M., Lotze M. T., Storkus W. J., Appella E., DeLeo A. B. Therapy of murine tumors with p53 wild-type and mutant sequence peptide-based vaccines. J. Exp. Med., 183: 1357-1365, 1996.[Abstract/Free Full Text]
  4. Nijman H. W., Van der Burg S. H., Vierboom M. P., Houbiers J. G., Kast W. M., Melief C. J. p53, a potential target for tumor-directed T cells. Immunol. Lett., 40: 171-178, 1994.[Medline]
  5. Ropke M., Hald J., Guldberg P., Zeuthen J., Norgaard L., Fugger L., Svejgaard A., Van der Burg S., Nijman H. W., Melief C. J., Claesson M. H. Spontaneous human squamous cell carcinomas are killed by a human cytotoxic T lymphocyte clone recognizing a wild-type p53-derived peptide. Proc. Natl. Acad. Sci. USA, 93: 14704-14707, 1996.[Abstract/Free Full Text]
  6. Yanuck M., Carbone D. P., Pendleton C. D., Tsukui T., Winter S. F., Minna J. D., Berzofsky J. A. A mutant p53 tumor suppressor protein is a target for peptide-induced CD8+ cytotoxic T-cells. Cancer Res., 53: 3257-3261, 1993.[Abstract/Free Full Text]
  7. Tuting T., DeLeo A. B., Lotze M. T., Storkus W. J. Genetically modified bone marrow-derived dendritic cells expressing tumor-associated viral or "self" antigens induce antitumor immunity in vivo. Eur. J. Immunol., 27: 2702-2707, 1997.[Medline]
  8. Hurpin C., Rotarioa C., Bisceglia H., Chevalier M., Tartaglia J., Erdile L. The mode of presentation and route of administration are critical for the induction of immune responses to p53 and antitumor immunity. Vaccine, 16: 208-215, 1998.[Medline]
  9. Roth J., Dittmer D., Rea D., Tartaglia J., Paoletti E., Levine A. J. p53 as a target for cancer vaccines: recombinant canarypox virus vectors expressing p53 protect mice against lethal tumor cell challenge. Proc. Natl. Acad. Sci. USA, 93: 4781-4786, 1996.[Abstract/Free Full Text]
  10. Hernandez J., Ko A., Sherman L. A. CTLA-4 blockade enhances the CTL responses to the p53 self-tumor antigen. J. Immunol., 166: 3908-3914, 2001.[Abstract/Free Full Text]
  11. Hernandez J., Lee P. P., Davis M. M., Sherman L. A. The use of HLA A2.1/p53 peptide tetramers to visualize the impact of self tolerance on the TCR repertoire. J. Immunol., 164: 596-602, 2000.[Abstract/Free Full Text]
  12. Theobald M., Biggs J., Hernandez J., Lustgarten J., Labadie C., Sherman L. A. Tolerance to p53 by A2.1-restricted cytotoxic T lymphocytes. J. Exp. Med., 185: 833-841, 1997.[Abstract/Free Full Text]
  13. Erdile L. F., Smith D. CD40 activation enhances the magnitude of cellular immune responses against p53 but not the avidity of the effectors. Cancer Immunol. Immunother., 49: 410-416, 2000.[Medline]
  14. Schlichtholz B., Legros Y., Gillet D., Gaillard C., Marty M., Lane D., Calvo F., Soussi T. The immune response to p53 in breast cancer patients is directed against immunodominant epitopes unrelated to the mutational hot spot. Cancer Res., 52: 6380-6384, 1992.[Abstract/Free Full Text]
  15. Winter S. F., Minna J. D., Johnson B. E., Takahashi T., Gazdar A. F., Carbone D. P. Development of antibodies against p53 in lung cancer patients appears to be dependent on the type of p53 mutation. Cancer Res., 52: 4168-4174, 1992.[Abstract/Free Full Text]
  16. Lubin R., Zalcman G., Bouchet L., Tredanel J., Legros Y., Cazals D., Hirsch A., Soussi T. Serum p53 antibodies as early markers of lung cancer. Nat. Med., 1: 701-702, 1995.[Medline]
  17. Peyrat J. P., Bonneterre J., Lubin R., Vanlemmens L., Fournier J., Soussi T. Prognostic significance of circulating P53 antibodies in patients undergoing surgery for locoregional breast cancer. Lancet, 345: 621-622, 1995.[Medline]
  18. Laurent-Puig P., Lubin R., Semhoun-Ducloux S., Pelletier G., Fourre C., Ducreux M., Briantais M. J., Buffet C., Soussi T. Antibodies against p53 protein in serum of patients with benign or malignant pancreatic and biliary diseases. Gut, 36: 455-458, 1995.[Abstract/Free Full Text]
  19. Labrecque S., Naor N., Thomson D., Matlashewski G. Analysis of the anti-p53 antibody response in cancer patients. Cancer Res., 53: 3468-3471, 1993.[Abstract/Free Full Text]
  20. Bourhis J., Lubin R., Roche B., Koscielny S., Bosq J., Dubois I., Talbot M., Marandas P., Schwaab G., Wibault P., Luboinski B., Eschwege F., Soussi T. Analysis of p53 serum antibodies in patients with head and neck squamous cell carcinoma. J. Natl. Cancer Inst., 88: 1228-1233, 1996.[Abstract/Free Full Text]
  21. Vennegoor C. J., Nijman H. W., Drijfhout J. W., Vernie L., Verstraeten R. A., von Mensdorff-Pouilly S., Hilgers J., Verheijen R. H., Kast W. M., Melief C. J., Kenemans P. Autoantibodies to p53 in ovarian cancer patients and healthy women: a comparison between whole p53 protein and 18-mer peptides for screening purposes. Cancer Lett., 116: 93-101, 1997.[Medline]
  22. Houbiers J. G., van der Burg S. H., van de Watering L. M., Tollenaar R. A., Brand A., van de Velde C. J., Melief C. J. Antibodies against p53 are associated with poor prognosis of colorectal cancer. Br. J. Cancer, 72: 637-641, 1995.[Medline]
  23. Coffman R. L., Seymour B. W., Lebman D. A., Hiraki D. D., Christiansen J. A., Shrader B., Cherwinski H. M., Savelkoul H. F., Finkelman F. D., Bond M. W., et al The role of helper T cell products in mouse B cell differentiation and isotype regulation. Immunol. Rev., 102: 5-28, 1988.[Medline]
  24. Ossendorp F., Mengede E., Camps M., Filius R., Melief C. J. Specific T helper cell requirement for optimal induction of cytotoxic T lymphocytes against major histocompatibility complex class II negative tumors. J. Exp. Med., 187: 693-702, 1998.[Abstract/Free Full Text]
  25. Hung K., Hayashi R., Lafond-Walker A., Lowenstein C., Pardoll D., Levitsky H. The central role of CD4(+) T cells in the antitumor immune response. J. Exp. Med., 188: 2357-2368, 1998.[Abstract/Free Full Text]
  26. Pardoll D. M., Topalian S. L. The role of CD4+ T cell responses in antitumor immunity. Curr. Opin. Immunol., 10: 588-594, 1998.[Medline]
  27. Toes R. E., Ossendorp F., Offringa R., Melief C. J. CD4 T cells and their role in antitumor immune responses. J. Exp. Med., 189: 753-756, 1999.[Free Full Text]
  28. Bennett S. R., Carbone F. R., Karamalis F., Flavell R. A., Miller J. F., Heath W. R. Help for cytotoxic-T-cell responses is mediated by CD40 signalling. Nature (Lond.), 393: 478-480, 1998.[Medline]
  29. Ridge J. P., Di Rosa F., Matzinger P. A conditioned dendritic cell can be a temporal bridge between a CD4+ T-helper and a T-killer cell. Nature (Lond.), 393: 474-478, 1998.[Medline]
  30. Schoenberger S. P., Toes R. E., van der Voort E. I., Offringa R., Melief C. J. T-cell help for cytotoxic T lymphocytes is mediated by CD40-CD40L interactions. Nature (Lond.), 393: 480-483, 1998.[Medline]
  31. Feltkamp M. C., Smits H. L., Vierboom M. P., Minnaar R. P., de Jongh B. M., Drijfhout J. W., ter Schegget J., Melief C. J., Kast W. M. Vaccination with cytotoxic T lymphocyte epitope-containing peptide protects against a tumor induced by human papillomavirus type 16-transformed cells. Eur. J. Immunol., 23: 2242-2249, 1993.[Medline]
  32. Franken K. L., Hiemstra H. S., van Meijgaarden K. E., Subronto Y., den Hartigh J., Ottenhoff T. H., Drijfhout J. W. Purification of his-tagged proteins by immobilized chelate affinity chromatography: the benefits from the use of organic solvent. Protein Expr. Purif., 18: 95-99, 2000.[Medline]
  33. van Hall T., van de Rhee N. E., Schoenberger S. P., Vierboom M. P., Verreck F. A., Melief C. J., Offringa R. Cryptic open reading frames in plasmid vector backbone sequences can provide highly immunogenic cytotoxic T-lymphocyte epitopes. Cancer Res., 58: 3087-3093, 1998.[Abstract/Free Full Text]
  34. Vierboom M. P., Zwaveling S., Bos G. M. J., Ooms M., Krietemeijer G. M., Melief C. J., Offringa R. High steady-state levels of p53 are not a prerequisite for tumor eradication by wild-type p53-specific cytotoxic T lymphocytes. Cancer Res., 60: 5508-5513, 2000.[Abstract/Free Full Text]
  35. Vierboom M. P., Nijman H. W., Offringa R., van der Voort E. I., van Hall T., van den Broek L., Fleuren G. J., Kenemans P., Kast W. M., Melief C. J. Tumor eradication by wild-type p53-specific cytotoxic T lymphocytes. J. Exp. Med., 186: 695-704, 1997.[Abstract/Free Full Text]
  36. Winzler C., Rovere P., Rescigno M., Granucci F., Penna G., Adorini L., Zimmermann V. S., Davoust J., Ricciardi-Castagnoli P. Maturation stages of mouse dendritic cells in growth factor-dependent long-term cultures. J. Exp. Med., 185: 317-328, 1997.[Abstract/Free Full Text]
  37. Rescigno M., Winzler C., Delia D., Mutini C., Lutz M., Ricciardi-Castagnoli P. Dendritic cell maturation is required for initiation of the immune response. J. Leukoc. Biol., 61: 415-421, 1997.[Medline]
  38. Rudensky A., Preston-Hurlburt P., al-Ramadi B. K., Rothbard J., Janeway C. A., Jr. Truncation variants of peptides isolated from MHC class II molecules suggest sequence motifs. Nature (Lond.), 359: 429-431, 1992.[Medline]
  39. Itoh Y., Kajino K., Ogasawara K., Katoh M., Namba K., Takami K., Iwabuchi K., Braunstein N. S., Onoe K. Determination of the allele-specific antigen-binding site on I-Ak and I-Ab molecules. Eur. J. Immunol., 26: 1314-1321, 1996.[Medline]
  40. Tindle R. W., Fernando G. J., Sterling J. C., Frazer I. H. A "public" T-helper epitope of the E7 transforming protein of human papillomavirus 16 provides cognate help for several E7 B-cell epitopes from cervical cancer-associated human papillomavirus genotypes. Proc. Natl. Acad. Sci. USA, 88: 5887-5891, 1991.[Abstract/Free Full Text]
  41. Takahashi H., Germain R. N., Moss B., Berzofsky J. A. An immunodominant class I-restricted cytotoxic T lymphocyte determinant of human immunodeficiency virus type 1 induces CD4 class II-restricted help for itself. J. Exp. Med., 171: 571-576, 1990.[Abstract/Free Full Text]
  42. Ou D., Jonsen L. A., Metzger D. L., Tingle A. J. CD4+ and CD8+ T-cell clones from congenital rubella syndrome patients with IDDM recognize overlapping GAD65 protein epitopes. Implications for HLA class I and II allelic linkage to disease susceptibility. Hum. Immunol., 60: 652-664, 1999.[Medline]
  43. Shirai M., Pendleton C. D., Ahlers J., Takeshita T., Newman M., Berzofsky J. A. Helper-cytotoxic T lymphocyte (CTL) determinant linkage required for priming of anti-HIV CD8+ CTL in vivo with peptide vaccine constructs. J. Immunol., 152: 549-556, 1994.[Abstract]
  44. Partidos C. D., Vohra P., Steward M. W. Induction of measles virus-specific cytotoxic T-cell responses after intranasal immunization with synthetic peptides. Immunology, 87: 179-185, 1996.[Medline]
  45. Lanzavecchia A. Mechanisms of antigen uptake for presentation. Curr. Opin. Immunol., 8: 348-354, 1996.[Medline]
  46. Regnault A., Lankar D., Lacabanne V., Rodriguez A., Thery C., Rescigno M., Saito T., Verbeek S., Bonnerot C., Ricciardi-Castagnoli P., Amigorena S. Fc{gamma} receptor-mediated induction of dendritic cell maturation and major histocompatibility complex class I-restricted antigen presentation after immune complex internalization. J. Exp. Med., 189: 371-380, 1999.[Abstract/Free Full Text]
  47. Schuurhuis D. H., Ioan-Facsinay A., Nagelkerken B., van Schip J. J., Sedlik C., Melief C. J., Verbeek J. S., Ossendorp F. Antigen-antibody immune complexes empower dendritic cells to efficiently prime specific CD8+ CTL responses in vivo. J. Immunol., 168: 2240-2246, 2002.[Abstract/Free Full Text]
  48. Greenberg P. D. Adoptive T cell therapy of tumors: mechanisms operative in the recognition and elimination of tumor cells. Adv. Immunol., 49: 281-355, 1991.[Medline]
  49. Kast W. M., Bronkhorst A. M., de Waal L. P., Melief C. J. Cooperation between cytotoxic and helper T lymphocytes in protection against lethal Sendai virus infection. Protection by T cells is MHC-restricted and MHC-regulated; a model for MHC-disease associations. J. Exp. Med., 164: 723-738, 1986.[Abstract/Free Full Text]
  50. van der Burg S. H., de Cock K., Menon A. G., Franken K. L., Palmen M., Redeker A., Drijfhout J., Kuppen P. J., van de Velde C., Erdile L., Tollenaar R. A., Melief C. J., Offringa R. Long lasting p53-specific T cell memory responses in the absence of anti-p53 antibodies in patients with resected primary colorectal cancer. Eur. J. Immunol., 31: 146-155, 2001.[Medline]
  51. Fedoseyeva E. V., Boisgerault F., Anosova N. G., Wollish W. S., Arlotta P., Jensen P. E., Ono S. J., Benichou G. CD4+ T cell responses to self- and mutated p53 determinants during tumorigenesis in mice. J. Immunol., 164: 5641-5651, 2000.[Abstract/Free Full Text]
  52. Fujita H., Senju S., Yokomizo H., Saya H., Ogawa M., Matsushita S., Nishimura Y. Evidence that HLA class II-restricted human CD4+ T cells specific to p53 self peptides respond to p53 proteins of both wild and mutant forms. Eur. J. Immunol., 28: 305-316, 1998.[Medline]
  53. Ashcroft M., Vousden K. H. Regulation of p53 stability. Oncogene, 18: 7637-7643, 1999.[Medline]
  54. Offringa R., Vierboom M. P., van der Burg S. H., Erdile L., Melief C. J. p53: a potential target antigen for immunotherapy of cancer. Ann. N Y Acad. Sci., 910: 223-233, discussion 233–236 2000.[Medline]
  55. Ras E., van der Burg S. H., Zegveld S. T., Brandt R. M., Kuppen P. J., Offringa R., Warnarr S. O., van de Velde C. J., Melief C. J. Identification of potential HLA-A *0201 restricted CTL epitopes derived from the epithelial cell adhesion molecule (Ep-CAM) and the carcinoembryonic antigen (CEA). Hum. Immunol., 53: 81-89, 1997.[Medline]
  56. Mizobata S., Tompkins K., Simpson J. F., Shyr Y., Primus F. J. Induction of cytotoxic T cells and their antitumor activity in mice transgenic for carcinoembryonic antigen. Cancer Immunol. Immunother., 49: 285-295, 2000.[Medline]
  57. Trojan A., Witzens M., Schultze J. L., Vonderheide R. H., Harig S., Krackhardt A. M., Stahel R. A., Gribben J. G. Generation of cytotoxic T lymphocytes against native and altered peptides of human leukocyte antigen-A*0201 restricted epitopes from the human epithelial cell adhesion molecule. Cancer Res., 61: 4761-4765, 2001.[Abstract/Free Full Text]



This article has been cited by other articles:


Home page
Clin. Cancer Res.Home page
F. M. Speetjens, P. J.K. Kuppen, M. J.P. Welters, F. Essahsah, A. M. E.G. Voet van den Brink, M. G. K. Lantrua, A. R. P.M. Valentijn, J. Oostendorp, L. M. Fathers, H. W. Nijman, et al.
Induction of p53-Specific Immunity by a p53 Synthetic Long Peptide Vaccine in Patients Treated for Metastatic Colorectal Cancer
Clin. Cancer Res., February 1, 2009; 15(3): 1086 - 1095.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
M. M. Lauwen, S. Zwaveling, L. de Quartel, S. C. Ferreira Mota, J. A.C. Grashorn, C. J.M. Melief, S. H. van der Burg, and R. Offringa
Self-Tolerance Does Not Restrict the CD4+ T-Helper Response against the p53 Tumor Antigen
Cancer Res., February 1, 2008; 68(3): 893 - 900.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
C. Erfurt, Z. Sun, I. Haendle, B. Schuler-Thurner, C. Heirman, K. Thielemans, P. van der Bruggen, G. Schuler, and E. S. Schultz
Tumor-Reactive CD4+ T Cell Responses to the Melanoma-Associated Chondroitin Sulphate Proteoglycan in Melanoma Patients and Healthy Individuals in the Absence of Autoimmunity
J. Immunol., June 15, 2007; 178(12): 7703 - 7709.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
S. J. Antonia, N. Mirza, I. Fricke, A. Chiappori, P. Thompson, N. Williams, G. Bepler, G. Simon, W. Janssen, J.-H. Lee, et al.
Combination of p53 Cancer Vaccine with Chemotherapy in Patients with Extensive Stage Small Cell Lung Cancer
Clin. Cancer Res., February 1, 2006; 12(3): 878 - 887.
[Abstract] [Full Text] [PDF]


Home page
Exp. Biol. Med.Home page
B. Wu, A. Ootani, R. Iwakiri, Y. Sakata, T. Fujise, S. Amemori, F. Yokoyama, S. Tsunada, S. Toda, and K. Fujimoto
T Cell Deficiency Leads to Liver Carcinogenesis in Azoxymethane-Treated Rats
Experimental Biology and Medicine, January 1, 2006; 231(1): 91 - 98.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
C. Kudo-Saito, J. Schlom, K. Camphausen, C. N. Coleman, and J. W. Hodge
The Requirement of Multimodal Therapy (Vaccine, Local Tumor Radiation, and Reduction of Suppressor Cells) to Eliminate Established Tumors
Clin. Cancer Res., June 15, 2005; 11(12): 4533 - 4544.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
M. Chakraborty, S. I. Abrams, C. N. Coleman, K. Camphausen, J. Schlom, and J. W. Hodge
External Beam Radiation of Tumors Alters Phenotype of Tumor Cells to Render Them Susceptible to Vaccine-Mediated T-Cell Killing
Cancer Res., June 15, 2004; 64(12): 4328 - 4337.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
K. Chikamatsu, A. Albers, J. Stanson, W. W. Kwok, E. Appella, T. L. Whiteside, and A. B. DeLeo
p53110-124-specific Human CD4+ T-helper Cells Enhance in Vitro Generation and Antitumor Function of Tumor-reactive CD8+ T Cells
Cancer Res., July 1, 2003; 63(13): 3675 - 3681.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zwaveling, S.
Right arrow Articles by Melief, C. J. M.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online