| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
Advances in Brief |
Surgery Branch, National Cancer Institute, Center for Cancer Research, NIH, Bethesda, Maryland
| ABSTRACT |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
A constitutively activating somatic mutation in the signaling molecule B-Raf is associated with >60% of malignant melanomas (2) . B-Raf is a member of the mitogen-activated protein (MAP) kinase cascade that transduces extracellular mitogenic signals to the cell nucleus, controlling cell growth, differentiation, and survival. Complete activation of B-Raf requires the phosphorylation of two residues, Thr598 and Ser601, with Thr598 playing the dominant role (3) . The BRAF point mutation T1796A commonly expressed in melanomas results in the missense V599E conversion, presumably mimicking phosphorylation of Thr598 and conferring activation. Of note, the B-Raf V599E mutation is associated not only with melanomas but also with 82% of benign nevi (4) , suggesting a role in carcinogenesis. In addition, its importance for maintaining the malignant cell phenotype has been revealed recently with RNA interference techniques (5) . Pharmacological inhibition of B-Raf has thus been proposed as a treatment for melanoma (6) . Considering mutated B-Raf as a potential target for immunotherapy, we sought in the current study to assess the capacity of CD4+ T cells from melanoma patients harboring the V599E mutation to specifically recognize this molecule.
| Materials and Methods |
|---|
|
|
|---|
BRAF DNA Sequencing.
Genomic DNA was isolated from fresh cryopreserved peripheral blood mononuclear cells (PBMCs), cultured melanomas, and EBV-B cells, and fresh cryopreserved enzymatically digested single cell suspensions of metastatic melanoma lesions using the Easy-DNA kit (Invitrogen, Carlsbad, CA). BRAF exon 15 was amplified with 35 cycles of PCR, and the products were gel-purified and directly sequenced. Previously published intronic primers were used for the PCR and for genomic DNA sequencing (2)
. Because melanin in the heavily pigmented melanomas 553-mel, 1011-mel, 1088-mel, and 1350-mel interfered with the PCR, it was necessary to use reverse-transcribed cDNA rather than genomic DNA as the template for PCR and sequencing of these cell lines. The following primers (based on GenBank sequence accession no. M95712) were used for reverse transcription-PCR with an annealing temperature of 50°C to produce and sequence an amplicon of 380 bp: forward, 5'- GACAGACTGCACAGGGCATG-3'; reverse, 5'-GTTACTCCGTACCTTACTGA-3'.
HLA Typing.
The major histocompatibility complex (MHC) class II genotypes of melanoma patients under study were determined from fresh PBMCs by the NIH W.G. Magnuson Clinical Center HLA Laboratory (Bethesda, MD) using sequence-specific PCR techniques. The HLA type of patient 2069 was DRB1*0404, 14; DQB1*03, 0503; DRB3*02; DRB4*01; and DPB1*0201, 0401. In addition, melanoma cell cultures and EBV-B cells used in this study were subjected to HLA genotyping.
Peptides.
Peptides used in this study were synthesized with Fmoc chemistry, and their purity was confirmed with mass spectrometry. A 29-mer B-Raf peptide containing the V599E mutation, B-Raf 585613mut, had the sequence EDLTVKIGDFGLATEKSRWSGSHQFEQLS. The artificial "universal" pan-DR epitope designated PADRE had the sequence AKFVAAWTLKAAA (7)
. The mutated triosephosphate isomerase (TPI) peptide TPI 2638 T28I, specifically recognized by CD4+ tumor infiltrating lymphocyte (TIL) 1558 reactive against autologous melanoma cells, had the sequence IGILNAAKVPADT (8)
. The influenza hemagglutinin (HA) peptide HA 307319 had the sequence PKYVKQNTLKLAT. The tetanus toxoid 830843 peptide had the sequence QYIKANSKFIGITE.
T-Cell Cultures.
CD4+ T-cell microcultures were initiated by peptide stimulation of fresh cryopreserved PBMCs from three melanoma patients whose metastatic tumors harbored the T1796A (V599E) BRAF mutation. PBMCs were cultured in flat-bottomed 96-well plates at 3 x 105 cells/well in RPMI 1640 +10% heat-inactivated human AB serum. Granulocyte macrophage colony-stimulating factor (GM-CSF; 200 units/ml) and interleukin 4 (100 units/ml; PeproTech Inc., Rocky Hill, NJ) were added to cultures only on day 0 to generate dendritic cells as antigen presenting cells (APCs), along with 50 µM of the mutated B-Raf peptide or a positive control peptide pool consisting of 10 µM each of the peptides tetanus toxoid 830843, HA 307319, and PADRE. Recombinant interleukin 2 (150 IU/ml) was added to T-cell cultures on day 6 and replenished every 47 days. Thereafter, T-cell microcultures were restimulated every 1014 days with irradiated autologous PBMCs or EBV-B cells pulsed with the appropriate peptide(s) at 1 x 105 feeder cells/well. Long-term CD4+ T-cell cultures were maintained in 300 IU/ml interleukin 2 and 20% conditioned medium from lymphokine activated killer cell cultures. As a control in some experiments, CD4+ TILs from patient number 1558, recognizing the HLA-DR1-restricted mutated epitope TPI 2638 T28I, were used (8)
.
T-Cell Recognition Assays.
To assess specific peptide recognition by T cells, 0.21 x 105 T cells/well were stimulated overnight in flat-bottomed 96-well plates with 1 x 105 autologous PBMCs or EBV-B cells that had been prepulsed for 1624 h with 50 µM of peptide, either B-Raf 585613mut or an irrelevant peptide (TPI 2638 T28I or HA 307319). Culture supernatants were then harvested, and GM-CSF or IFN
secretion by T cells was measured using commercially available ELISA kits (R&D Systems, Minneapolis, MN). When allogeneic EBV-B cells were used as APCs to determine the MHC restriction of peptide-specific T cells, care was taken to wash excess peptide off APC before combining them with T cells. Whole tumor cell recognition was tested by incubating T cells (1 x 105/well) in microtiter plates with melanoma cells (1 x 105/well) for 20 h. To up-regulate the expression of MHC class II molecules on melanoma cells, melanomas were cultured in the presence of IFN
(500 units/ml) for 3 days before T-cell recognition assays, and cell surface expression of MHC molecules was assessed by flow cytometry on the day of the assay. In some assays, monoclonal antibodies (mAbs) directed against MHC molecules were used to inhibit T-cell reactivity, including W6/32 (IgG2a, anti-MHC class I), IVA12 (IgG1, anti-HLA-DR, -DP, ?-DQ), L243 (IgG2a, anti-HLA-DR), IVD12 (IgG1, anti-HLA-DQ3), Genox 3.53 (IgG1, anti-HLA-DQ1), G2b.2 (IgG2a, anti-HLA-DQ1; all purified hybridoma supernatants, American Type Culture Collection, Manassas, VA), and B7/21 (IgG3, anti-HLA-DP; BD Biosciences, San Diego, CA). Final concentrations of mAb in blocking assays were 5 µg/ml for B7/21 and 20 µg/ml for the others. The mAb NFLD.D1 specific for HLA-DR4 (Accurate Chemical, Westbury, NY) was used for flow cytometry.
| Results and Discussion |
|---|
|
|
|---|
|
secretion. PBMCs from patient 2069 generated the greatest number of specific microcultures (15%, similar to reactivity of PBMCs stimulated against the positive control peptide pool), and these sustained their proliferation and reactivity through multiple culture passages. Thus, T cells derived from patient 2069 were chosen for in-depth analysis.
CD4+ T Cells from Patient 2069 Use 3 Different HLA Alleles for Recognizing the Mutated B-Raf Peptide.
Three individual T-cell microcultures from patient 2069, designated A4, B5, and F2, were studied to identify the MHC allele(s) restricting recognition of the B-Rafmut peptide. Cultures A4 and F2 were pure CD4+ T-cell populations as assessed by flow cytometry, whereas B5 was 83% CD4 positive. To determine the MHC restriction of these T cells, allogeneic EBV-B cell lines sharing various HLA-DR, -DQ, and/or -DP alleles with patient 2069 were used as APC for exogenously pulsed B-Rafmut peptide. Peptide-pulsed K562 erythroleukemia cells devoid of cell surface MHC molecules were used as a negative control. As shown in Table 2
, CD4+ A4 T cells specifically recognized the B-Rafmut peptide pulsed onto autologous EBV-B cells or onto allogeneic APCs sharing HLA-DQB1*05 and did not recognize the irrelevant HA 307319 peptide. In contrast, B5 T cells required allogeneic APCs that expressed HLA-DPB1*0401 for B-Rafmut peptide recognition. Finally, F2 T cells recognized the B-Rafmut peptide pulsed onto 583-EBV sharing only HLA-DRB1*0404 with patient 2069. B-Rafmut could be recognized at limiting concentrations of 0.55 µM (data not shown). Additional HLA typing of the DRB3, DRB4, and DRB5 loci did not reveal any patterns among APCs that were consistent with the profiles of T-cell activity observed (data not shown). Thus, it appeared that CD4+ T-cell cultures generated from 1 melanoma patient could use three different MHC class II alleles to recognize a single 29-mer B-Raf peptide containing the V599E mutation.
|
|
50 µM. B5 T cells demonstrated preferential recognition of the mutated 29-mer, reacting against the wild-type B-Raf 585613 peptide to a lesser degree (data not shown). Additional investigations focused on the A4 and F2 T cells that were exclusively specific for B-Rafmut.
Peptide-Specific F2 CD4+ T Cells Recognize Whole Melanoma Cells Containing a Mutated BRAF Allele.
T cells sensitized by repetitive in vitro stimulation with synthetic peptides may fail to recognize the naturally processed parent protein. This can occur because a hypothetical epitope is not actually generated by intracellular processing, because the synthetic peptide used for in vitro stimulation contains chemical impurities or sequence irregularities provoking T-cell reactivity, or because the conformation of an exogenously pulsed peptide complexed to MHC fails to reproduce the conformation of a naturally processed epitope loaded intracellularly onto MHC molecules (14)
. Thus, we next sought to determine whether CD4+ T cells raised against and specific for the B-Rafmut peptide could also specifically recognize whole melanoma cells expressing both mutated BRAF and the appropriate class II allele. F2 T cells were tested for recognition of a panel of cultured melanomas that had been characterized with BRAF exon 15 DNA sequencing (Table 1)
as well as MHC class II genotyping. Because not all of the melanoma targets constitutively expressed significant amounts of cell surface class II molecules, they were cultured in the presence of IFN
for 72 h before the assay, and the induction or enhancement of HLA-DR expression was confirmed with flow cytometry. As shown in Table 3
, F2 T cells secreted GM-CSF specifically in response to melanomas expressing both mutated B-Raf and HLA-DRB1*0404. Expression of either molecule alone was not sufficient for T-cell recognition. Thus, 1558-mel, expressing mutated B-Raf but not the appropriate restricting allele, was not recognized by F2 T cells but could be recognized by HLA-DR1-restricted CD4+ TIL 1558 specific for mutated TPI (8)
. Similarly, 1011-mel, expressing the appropriate restriction element but not the V599E B-Raf mutation, was not recognized by F2 T cells. Whereas 397-mel was well recognized based on its coexpression of mutated B-Raf and HLA-DR4, there was no recognition of T lymphoblasts from patient 397 (397 TIL) that nevertheless demonstrated strong cell surface expression of DR molecules (Table 3)
and specifically of HLA-DR4 (data not shown). Of note, 1898-mel was not recognized by F2 T cells despite containing the V599E mutation and DRB1*0404 as assessed on a genetic level. Unexpectedly, whereas flow cytometric analysis of 1898-mel with the mAb L243 showed adequate cell surface expression of HLA-DR (Table 3)
, subsequent analysis with an HLA-DR4-specific mAb failed to detect expression of this allele, consistent with the failure of F2 recognition. In two separate experiments (data not shown), F2 T cells recognizing IFN
-treated 397-mel failed to react against IFN
-treated cultured fibroblasts from patient 2069 expressing HLA-DR, nor did they recognize additional allogeneic melanomas that contained mutated B-Raf but not HLA-DRB1*0404 (586-mel, 624-mel, 938-mel, and 1087-mel). Fresh 2069 melanoma cells expressed HLA-DR poorly by immunostaining and were not recognized. Taken together, these results demonstrate the Ag specificity and MHC class II restriction of CD4+ F2 T cells. Moreover, they provide evidence that endogenously expressed mutant B-Raf protein can be processed within melanoma cells and presented in association with MHC molecules, becoming a target for immune recognition.
|
In summary, our findings indicate that the B-Raf V599E mutation commonly expressed in melanomas can be displayed by tumor cells for CD4+ T-cell recognition. A single 29-mer peptide incorporating the V599E point mutation has the capacity to stimulate MHC class II-restricted responses through multiple alleles and, thus, has potential clinical utility. Because this mutation is somatically acquired, immunotherapies directed at B-Raf V599E may circumvent issues of immunological tolerance encountered with the clinical application of nonmutated self-Ag. Furthermore, molecules such as mutant B-Raf, of which the expression appears to be important for maintaining the malignant phenotype, may provide ideal targets for cancer immunotherapy.
| ACKNOWLEDGMENTS |
|---|
| FOOTNOTES |
|---|
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
Notes: M. S. Sharkey and G. Lizée contributed equally to this work.
Requests for reprints: Suzanne Topalian, Surgery Branch, National Cancer Institute, NIH 10/2B47, Bethesda, MD 20892-1502. Phone: (301) 496-4269; Fax: (301) 402-0922; E-mail: Suzanne_Topalian{at}nih.gov
Received 10/14/03. Revised 1/ 9/04. Accepted 1/15/04.
| REFERENCES |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
T. Sittler, J. Zhou, J. Park, N. K. Yuen, S. Sarantopoulos, J. Mollick, R. Salgia, A. Giobbie-Hurder, G. Dranoff, and F. S. Hodi Concerted Potent Humoral Immune Responses to Autoantigens Are Associated with Tumor Destruction and Favorable Clinical Outcomes without Autoimmunity Clin. Cancer Res., June 15, 2008; 14(12): 3896 - 3905. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Vineis and M. Berwick The population dynamics of cancer: a Darwinian perspective Int. J. Epidemiol., October 1, 2006; 35(5): 1151 - 1159. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Sensi and A. Anichini Unique Tumor Antigens: Evidence for Immune Control of Genome Integrity and Immunogenic Targets for T Cell-Mediated Patient-Specific Immunotherapy Clin. Cancer Res., September 1, 2006; 12(17): 5023 - 5032. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. R. Lindsey, L. Gritz, R. Sherry, A. Abati, P. A. Fetsch, L. C. Goldfeder, M. I. Gonzales, K. A. Zinnack, L. Rogers-Freezer, L. Haworth, et al. Evaluation of Prime/Boost Regimens Using Recombinant Poxvirus/Tyrosinase Vaccines for the Treatment of Patients with Metastatic Melanoma Clin. Cancer Res., April 15, 2006; 12(8): 2526 - 2537. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. N. Houghton Recognition of Cancer by the Immune System Am. Assoc. Cancer Res. Educ. Book, April 1, 2006; 2006(1): 91 - 94. [Full Text] [PDF] |
||||
![]() |
R. Somasundaram, R. Swoboda, L. Caputo, L. Otvos, B. Weber, P. Volpe, P. van Belle, S. Hotz, D. E. Elder, F. M. Marincola, et al. Human Leukocyte Antigen-A2-Restricted CTL Responses to Mutated BRAF Peptides in Melanoma Patients. Cancer Res., March 15, 2006; 66(6): 3287 - 3293. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. H. Andersen, J. Fensterle, S. Ugurel, S. Reker, R. Houben, P. Guldberg, T. G. Berger, D. Schadendorf, U. Trefzer, E.-B. Brocker, et al. Immunogenicity of Constitutively Active V599EBRaf Cancer Res., August 1, 2004; 64(15): 5456 - 5460. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Cancer Research | Clinical Cancer Research |
| Cancer Epidemiology Biomarkers & Prevention | Molecular Cancer Therapeutics |
| Molecular Cancer Research | Cancer Prevention Research |
| Cancer Prevention Journals Portal | Cancer Reviews Online |
| Annual Meeting Education Book | Meeting Abstracts Online |