| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
Regular Articles |
1 Inserm U553, Hôpital Saint-Louis, Paris; 2 Bioalliance Pharma SA, Paris; 3 Unité Mixte de Recherche 8121, Centre National de la Recherche Scientifique, Institut Gustave-Roussy, Villejuif; 4 DIFEMA, Faculté de Médecine et Pharmacie de Rouen, Rouen; and 5 Laboratoires Sainte-Marie and EMI 353 INSERM, Hôtel-Dieu, Paris, France
| ABSTRACT |
|---|
|
|
|---|
5ß1 and
v, are preferentially expressed on endothelial cells on angiogenesis. Furthermore, metargidin interacts with these integrins via its disintegrin domain. In this study, recombinant human disintegrin domain (RDD) was produced in Escherichia coli by subcloning its cDNA into the pGEX-2T vector, and the effect of purified RDD on different steps of angiogenesis was evaluated. At concentrations of 210 µg/ml, RDD exhibited inhibitory activities in a variety of in vitro functional assays, including endothelial cell proliferation and adhesion on the integrin substrates fibronectin, vitronectin, and fibrinogen. RDD (10 µg/ml) totally abrogated endothelial cell migration and blocked most capillary formation in a three-dimensional fibrin gel. To test RDD efficacy in vivo, the RDD gene inserted into pBi vector containing a tetracycline-inducible promoter was electrotransferred into nude mouse muscle. RDD was successfully synthesized by muscle cells in vivo as shown by immunolabeling and Western blotting. In addition, 78% less MDA-MB-231 tumor growth, associated with strong inhibition of tumor angiogenesis, was observed in athymic mice bearing electrotransferred RDD. Moreover, in the presence of RDD, 74% fewer B16F10 melanoma lung metastases were found in C57BL/6 mice. Taken together, these results identified this RDD as a potent intrinsic inhibitor of angiogenesis, tumor growth, and metastasis, making it a promising tool for use in anticancer treatment. | INTRODUCTION |
|---|
|
|
|---|
The family of adamalysin proteins, also referred to as A disintegrin and metalloproteinase proteins (ADAMs) or metalloproteinase-disintegrin cysteine-rich proteins (MDCs), has a particular primary structure containing disintegrin domain located on the COOH-terminal side of metalloproteinase domain. The disintegrin region contains an integrin-binding sequence in a disintegrin loop that interacts with integrins and may mediate cellcell interactions (8) . All family members potentially possess cell-adhesion and protease activities; however, only half of them have been reported to have an active metalloproteinase site to mediate proteolytic cleavage of ECM components (9) . Adamalysins are implicated in diverse biological processes, such as fertilization, myogenesis, neurogenesis, and cytokine release (10) .
Metargidin (metalloprotease-RGD-disintegrin protein), also called human MDC-15 or ADAM-15, is a transmembrane adamalysin expressed by smooth muscle cells, mesangial cells, and at a much higher level, activated endothelial cells. To date, its function has remained poorly understood (11, 12, 13)
. However, recently reported data implicated metargidin in mesangial cell migration associated with the gelatinase activity of its metalloproteinase domain (13)
. Metargidin has also been shown to colocalize with a cell-adhesion molecule, vascular endothelial cadherin, which mediates endothelial cell adherent junction formation (14)
. Furthermore, metargidin is the only known adamalysin that possesses a RGD motif at the tip of its disintegrin loop (CRPTRGDCD), which binds integrins
vß3 and
5ß1 (11
, 15 , 16)
. More recently, mouse ADAM-15, a homolog of human metargidin, has been shown to bind integrin
9ß1 in an RGD-independent manner (17)
. Integrins are heterodimeric transmembrane cell-surface molecules that mediate adhesion to ECM and cellcell interactions (18)
. In particular,
v integrins are involved in angiogenic processes; monoclonal antibodies, e.g., vitaxin, and cyclic RGD peptides targeting these integrins inhibited angiogenesis, leading to tumor regression (18, 19, 20, 21, 22)
. However, the mechanisms of how
v integrins modulate angiogenesis remain unclear (23, 24, 25, 26, 27, 28, 29, 30)
because the deletion of ß3, ß5, or
v integrins in knockout mice failed to block angiogenesis but rather showed extensive angiogenesis (27
, 28)
.
In a previous study using a synthetic adamalysin inhibitor (GL129471) to block the metalloproteinase domain, we provided evidence implicating adamalysin in angiogenesis in vitro (31) . Because angiogenesis is thought to require the interaction between metargidin and integrin, we postulated that the disintegrin domain of metargidin, expressed as soluble recombinant protein, might prevent this interaction. To test this hypothesis, we produced this recombinant disintegrin domain (RDD) and evaluated its effect on angiogenesis in vitro. Moreover, the potential therapeutic efficacy of RDD against tumor angiogenesis, growth, and metastasis was evaluated after plasmid DNA electrotransfer using a previously described tetracycline-inducible system (32) in two experimental animal models: human MDA-MB-231 tumors grafted into nude mice, and the dissemination of B16F10 melanoma cells to the lungs of syngeneic mice.
| MATERIALS AND METHODS |
|---|
|
|
|---|
RDD Production in E. coli.
Glutathione S-transferase (GST)RDD fusion protein was prepared by inserting cDNA that encodes the entire disintegrin domain of metargidin (MAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGE) into the BamHI site of the pGEX-2T vector, yielding pGEX-2T-RDD, a generous gift from Y. Takada (The Scripps Research Institute, La Jolla, CA). This fusion protein has a thrombin cleavage site between GST and RDD. E. coli DH5
synthesis of GSTRDD was induced by incubating the bacteria in 1 mM isopropyl-1-thio-ß-D-galactopyranoside (Life Technologies, Inc., Paisley, United Kingdom) for 4 h. After addition of 1% Triton X-100, the bacterial suspension was sonicated, and the fusion protein was extracted. The fusion protein was purified by glutathione-agarose (Sigma-Aldrich, Saint Quentin Fallavier, France) affinity chromatography and eluted by competition with free glutathione (Sigma-Aldrich), as described by Smith and Johnson (33)
. RDD was cleaved from the fusion protein by use of bovine thrombin (Amersham Pharmacia; 1 unit/100 µg of fusion protein) for 16 h at room temperature. The GST fragment was then removed by glutathione-agarose affinity chromatography, and the final product was dialyzed against PBS for 3 h. Purified RDD (20 µl) was analyzed by use of a fast-performance liquid chromatography system (P-500 pump; Amersham Biosciences Europe, Orsay, France) with a Superdex 75 High Resolution 10/30 column (Amersham) connected to a Beckman Gold 168 spectrophotometer (detection at 230 nm; Beckman Instruments, Fullerton, CA) with PBS as the elution buffer at a flow rate of 0.5 ml/min and pressure of 0.7 MPa. The protein concentration was determined with the BCA assay (Pierce; Rockford, IL). Vehicle-control cultures (without RDD) for in vitro experiments contained a final bovine thrombin concentration never exceeding 1.6 units/ml (used for the highest RDD dose).
Plasmid Preparation for Electric Pulse Delivery to Muscle.
The cDNA containing the disintegrin domain sequence from pGEX-2TRDD was amplified by PCR with the forward primer 5'-ATC CGA GCT CTT ATG GCT GCT TTC TGC G-3' and the reverse primer 5'-GCA TGC GGA TCC TTA CTC GCC A-3' and subcloned into SacIBamHI sites of the p1519 vector, which harbors the sequence of mouse urokinase signal peptide (34)
. The EcoRVBamHI restriction fragment encoding this signal peptide-fused RDD sequence was then subcloned into EcoRVBglII sites of the pCO5 vector (Clontech, Palo Alto, CA). The NaeIEcoRV restriction fragment was finally subcloned into the EcoRV site of the pBi vector (Clontech). This vector (pBiRDD) carries the gene of interest from a tetracycline-responsive promoter in the Tet-On eukaryotic gene-expression system. The cDNA fragment of RDD fused to the urokinase signal peptide, with Flag-tag (DYKDDDDK) placed at the COOH terminus, was amplified by PCR from pBiRDD by use of the forward primer 5'-AAT ACT AGC TAG CAT GAA AGT CTG GCT G-3' and the reverse primer 5'-TTG ATA TCT CACTTG TCA TCG TCG TCC TTG TAG TCC TCG CCA TCC CCT AG-3'. The NheIEcoRV restriction fragment was then subcloned into NheI/EcoRV sites of pBi to generate pBiRDDFlag. The tag enables detection of muscle cell-synthesized RDD by Western blotting and immunolabeling of muscle sections. The Tet-On vector expressing the transactivator rtTA (reverse tetracycline transcriptional activator) and the Tet-tTS vector expressing the silencer tTS (tetracycline transcriptional silencer) were purchased from Clontech. Plasmids were prepared by use of the Endo-Free Plasmid Maxi kit (Qiagen, Courtaboeuf, France). Purified plasmid DNA was solubilized in endotoxin-free 0.9% NaCl at the working concentration.
Intramuscular Electrotransfer of Plasmid DNA.
Female nude (Janvier, Le Genest-sur-Isle, France) and C57BL/6 (Harlan, Gannat, France) mice, 8 weeks of age, were acclimated for 7 days and caged in groups of five or fewer. The hindlegs of C57BL/6 mice were shaved with an electric razor on the day before electrotransfer. Animals were anesthetized by intraperitoneal injection of ketamine (100 mg/kg of body weight; Ketalar; Panpharma, Fougères, France) and xylazine (40 mg/kg; Rompun; Bayer, Sens, France) before all procedures. Experiments were conducted in accordance with the recommendations of the NIH for animal experimentation. We injected 20 µg each of pBi (control), pBiRDD (experimental treatment), or pBiRDDFlag (to visualize RDD secreted by muscle cells), together with 10 µg of the Tet-tTS and 20 µg of the Tet-On plasmids, in sterile 0.9% NaCl (final volume, 30 µl) into the tibialis cranialis muscle, and electrotransfer was conducted as described previously (32
, 35)
. Briefly, eight transcutaneous square electric pulses (200 V/cm) were applied for 20 ms by use of two stainless steel plate electrodes placed
5.7 mm apart on the leg at a frequency of 1 Hz by use of a PS-15 electropulsator (Jouan, St. Herblain, France) to obtain muscle cell electroporation that allowed passage of plasmids into the cells. The entire procedure was repeated for the second leg.
Cell Lines and Culture.
Human microvascular endothelial cells (HMEC-1) were provided by Dr. E. W. Ades (CDC, Atlanta, GA), who established this line by transfecting human dermal endothelial cells with SV40 Large T antigen (36)
. HMEC-1 cells were grown as monolayers in MCDB 131 medium (Sigma-Aldrich) supplemented with 2 mM L-glutamine, 100 IU/ml penicillin, 100 µg/ml streptomycin, 10% FCS (Life Technologies, Inc.), 10 ng/ml epidermal growth factor (R&D Systems, Abingdon, United Kingdom), and 1 µg/ml hydrocortisone (Sigma-Aldrich). Human umbilical vein endothelial cells (HUVECs), obtained as described by Jaffe et al. (37)
, were grown in M199 culture medium supplemented with 20% FCS, 2 mM L-glutamine, 100 IU/ml penicillin, 100 µg/ml streptomycin, 75 mM HEPES, 3.7 mM sodium bicarbonate (pH 7.5), and 5 µg/ml fungizone (Life Technologies, Inc.). Human dermal microvascular endothelial cells (HMVEC-d; Biowhittaker Europe, Verviers, Belgium) were grown in EGM-2MV medium (Biowhittaker Europe) containing 10% FCS, 2 mM L-glutamine, 100 IU/ml penicillin, and 100 µg/ml streptomycin and used at passages 46. Calf pulmonary artery endothelial (CPAE) cells provided by Dr. J. Badet (Laboratoire de Biotechnologie des Cellules Eucaryotes, Université de Créteil, Créteil, France), were grown as monolayers in MEM supplemented with 20% FCS, 2 mM L-glutamine, 100 IU/ml penicillin, and 100 µg/ml streptomycin and used at passages 1220. Human mammary adenocarcinoma cell line MDA-MB-231 and murine skeletal muscle cell line C2C12 (American Type Culture Collection, Rockville, MD) were maintained in DMEM supplemented with 10% FCS, 2 mM L-glutamine, 100 IU/ml penicillin, and 100 µg/ml streptomycin. Murine melanoma B16F10 (ATCC) was grown in DMEM supplemented with 10% FCS, 2 mM L-glutamine, 100 IU/ml penicillin, and 100 µg/ml streptomycin, adjusted to contain 1.5 g/L of sodium bicarbonate (Invitrogen, Cergy-Pontoise, France). The six media supplemented as stated above for the seven corresponding cell lines are hereafter referred to as the appropriate complete media.
Assessment of Capillary Formation by Use of Microcarrier Beads in a Fibrin Gel.
HMEC-1-coated microcarrier beads were cultured according to the method of Nehls and Drenckhahn (38)
, and details of the experiment were described by Trochon et al. (31)
. Briefly, HMEC-1-covered beads were embedded in a fibrin matrix containing RDD (5 µg/ml) or bovine thrombin (0.8 units/ml) as the control. Sprouting of capillary-like tubes from the periphery of microcarrier beads was observed as of the fourth day of culture. This neovascularization was photographed with an Olympus OM-2 camera on an inverted microscope, and capillary lengths were measured on the photos.
Cell Proliferation Assay.
Cells were cultured in 96-well plates in the appropriate complete medium (2000 cells/well). After 24 h, the serum concentration in the same culture medium was halved to induce the cells to accumulate at the G0-G1 phase during the next 24 h. The cells were then cultured for 30 h in fresh medium with the full concentration in the presence of RDD at the indicated concentrations or 1.6 units/ml bovine thrombin. [3H]Thymidine (1 µCi/well) was then added to the cells and allowed to incorporate for 16 h. The incorporated [3H]thymidine was adsorbed on a filter paper with a Skatron (Lier, Norway) harvester, and the radioactivity was counted in a liquid scintillation counter (Beckman).
Assessment of Apoptosis by Flow Cytometry Analysis.
To detect and quantify apoptosis, we used the AnnexinV-FITC Kit (R&D Systems). Briefly, CPAE (1 x 106) cells were cultured for 24 h in the presence of RDD (5 µg/ml) or bovine thrombin (0.8 units/ml). Pellets of 1 x 106 cells were resuspended in 100 µl of the kit reaction buffer containing propidium iodide (5 µg/ml) and 1:100 AnnexinV-FITC, according the manufacturers instructions. After mixing, cells were incubated for 15 min in the dark at room temperature. Flow cytometry was performed on a FACS flow cytometer (EPICS XL-MCL; Coulter, Hialeah, FL). Experiments were run in triplicate.
Cell Attachment Assay.
We coated 96-well plates overnight at 4°C with 100 µl of fibrinogen (40 µg/ml; Sigma-Aldrich), vitronectin (10 µg/ml; Sigma-Aldrich), or fibronectin (30 µg/ml; Sigma-Aldrich) in PBS. Negative controls consisted of wells coated with 2% BSA. CPAE cells (1 x 106) were cultured with 10 µg/ml RDD or bovine thrombin (1.6 units/ml) for 48 h. Cells were then detached from culture flasks by incubation with 1.5 mM EDTA and resuspended to a final concentration of 5 x 105 cells/ml in adhesion buffer [140 mM NaCl, 10 mM HEPES, 5.56 mM glucose, 5.4 mM KCl, 2 mM CaCl2, 1 mM MgCl2, 1 mM MnCl2 (pH 7.4)]]. The cell suspension (100 µl) was incubated for 20 min at 37°C on coated plates. Nonadherent cells were removed by washing the wells three times with 200 µl of adhesion buffer containing 1% BSA. Adherent cells were quantified by measuring cell phosphatase activity. Briefly, 100 µl of p-nitrophenylphosphate (3 mg/ml; Sigma-Aldrich) in sodium acetate buffer (pH 5.5) containing 0.1% Triton X-100 were added to the wells and incubated for 2 h at 37°C. The reaction was then stopped by the addition of 65 µl of 1 N NaOH. Released p-nitrophenol, which indicates the number of adherent cells, was measured by reading the absorbance at 405 nm in an ELISA reader (Labsystem, Cergy Pontoise, France). Nonspecific binding on BSA-coated plates was subtracted from the raw data. All experiments were run in triplicate.
Endothelial Cell Migration Assay.
The migration assay was performed in 24-well culture plates, as described previously (39)
. Briefly, the wells were filled with 1.2% agarose (Sigma-Aldrich) dissolved in the culture medium, and the gel was allowed to set. The agarose cylinders were removed and cutoff in half, and each half was placed in a separate well into which 6.0 x 104 CPAE cells were deposited on the empty side and allowed to grow to confluence. The demi-agarose gel was then removed, RDD at the indicated concentrations or bovine thrombin (1.6 units/ml) was added, and the cells were allowed to migrate toward and through the newly created free space. Cell migration into free space could be measured by use of transparent graph paper stuck to the bottom of the culture plates.
Transient Transfection of C2C12 Skeletal Muscle Cells.
C2C12 murine muscle cells were routinely grown in the appropriate complete medium. C2C12 cells maintained in tetracycline-free serum (Clontech) for at least 1 week were transfected with equimolar amounts (3 µg of total DNA) of each plasmid (pBi, pBiRDD-Flag and both Tet-On and Tet-tTS) at 50% saturation in 6-well plates with Lipofectamine plus reagent (Life Technologies, Inc.), according to the protocol recommended by the manufacturer. Doxycycline (1 µg/ml final concentration; Sigma-Aldrich) was added daily to the culture medium starting on the day of transfection, and supernatants were collected 48 h later.
Subcellular Fractionation and Western Blotting.
The two tibialis cranialis muscles per mouse were washed in ice-cold PBS, minced with scissors, and homogenized in 800 µl of iced-cold PBS in a glass Potter Elvejem homogenizer (VWR International, Strasbourg, France). The homogenate was then centrifuged at 700 x g for 10 min at 4°C, and the supernatant was collected. To detect RDDFlag synthesized after electrotransfer of plasmids, 100 µg of total protein, determined with the BCA assay, were loaded on 1020% tricine gels from Novex (Invitrogen, Cergy-Pontoise, France). Proteins were separated electrophoretically and transferred to nitrocellulose membranes (Sartorius, Göttingen, Germany). Membranes were blocked for 1 h in 10% nonfat dry milk in Tris-buffered saline [10 mM Tris (pH 7.5), 200 mM NaCl] containing 0.05% Tween 20. Membranes were then either incubated with polyclonal rabbit anti-RDD serum (Neosystem, Strasbourg, France), diluted 1:1000, for 1 h to detect E. coli-produced RDD or rabbit anti-Flag antibody (5 µg/ml; Sigma) to visualize RDDFlag synthesized by skeletal muscle cells. After five washes with Tris-buffered salineTween, filters were incubated with an appropriate horseradish peroxidase-linked secondary antibody (Dako, Trappes, France), diluted 1:2000, for 1 h. Membranes were washed five times in Tris-buffered salineTween, and immunolabeling was detected by the enhanced chemiluminescence protocol (Amersham Pharmacia Biotech, Orsay, France).
Tumor Growth in Nude Mice.
The regulatory plasmids Tet-On and Tet-tTS, together with 20 µg of either pBiRDD or pBi (control), were electrotransferred into female nude mice. Cultured log-phase MDA-MB-231 cells were harvested with EDTA (0.2 g/L), washed, and resuspended in sterile PBS to a final concentration of 2 x 107 cells/ml. Cell suspension (200 µl) was injected s.c. into the backs of mice. Tumor size was monitored by measuring two perpendicular diameters with a dial caliper, and tumor volume was calculated as: (length x width/2)3 x
/6. When tumors reached
18 mm3 in volume, RDD synthesis was induced in plasmid-electrotransferred muscle by the addition of doxycycline (200 µg/ml) to drinking water supplemented with 5% sucrose. Tumor size was monitored until day 14 after initiation of doxycycline stimulation.
Melanoma Pulmonary Metastases in Syngeneic Mice.
The regulatory plasmids Tet-On and Tet-tTS together with 20 µg of either pBiRDD or pBi (control) were electrotransferred into female C57BL/6 mice, and doxycycline RDD induction (see above) was started 3 days before log-phase cultured B16F10 melanoma cells were detached with 0.02% EDTA and resuspended to the final concentration of 2 x 106/ml in sterile 0.9% NaCl. We injected 100 µl of the suspension i.v. into the retro-orbital sinus of the mice. Ten days later, the mice were sacrificed, the lungs were excised, and metastatic nodules were counted under a dissecting microscope.
Immunohistochemistry.
Paraffin sections (5-µm thick) of MDA-MB-231 tumor and tibialis cranialis muscles were cut, treated with xylene, rehydrated, and stained with H&Esaffranin. For immunohistochemistry, endogenous peroxidase activity was quenched by incubation with 3% H2O2 for 10 min. The sections were then washed in distilled water, incubated with blocking serum in Optimax wash buffer 1/10 (BioGenex, San Ramon, CA) for 10 min, and incubated with monoclonal rat anti-CD31 antibody (volume/volume mixture of MEC13.1 and 390; Becton Dickinson Europe, Le Pont De Claix, France), diluted 1:50, or polyclonal rabbit anti-Flag antibodies (Sigma), diluted 1:400, for 1 h. After two washes with Optimax, slides were incubated with peroxidase-conjugated goat polyclonal antirat or peroxidase-conjugated goat polyclonal antirabbit antibodies diluted 1:50, followed by two washes with Optimax. Slides were exposed to diaminobenzidine chromogenic substrate (PowerVision Histostaining Kit; ImmunoVision Technologies, Dady City, CA) for 10 min, washed with distilled water, counterstained with Mayers hematoxylin, and mounted in permanent medium (Pertex). All slides were immunolabeled the same day, thus assuring standardized intensities of immunochemical signals and counterstaining.
Image Analysis.
For each nude mouse, a representative histological sample, CD31-immunolabeled, was subjected to image analysis with a Zeiss Axiophot microscope coupled with a Sony 3 charge-coupled device camera (resolution, 768 x 576 pixels). Only viable tumor tissue was considered, excluding necrotic and fibrotic areas. For each specimen, the whole surface or eight contiguous fields were digitized when specimens were too large. Images were then analyzed with a specifically developed Linux-based program, as described by Martel-Renoir et al. (32)
.
| RESULTS |
|---|
|
|
|---|
|
|
|
Effect of RDD on Endothelial Cell Adhesion.
Endothelial cell adhesion to ECM essentially implicates integrins
vß3 and
5ß1, which have been reported to interact with metargidin (15
, 16)
. We therefore analyzed the RDD effect on CPAE adhesion to immobilized fibrinogen, vitronectin, or fibronectin. Cells were cultured for 2 days in the presence of RDD (2, 5, or 10 µg/ml), and their adhesion to each substrate was evaluated. RDD at 10 µg/ml inhibited CPAE adhesion by
30% (Fig. 3C)
, compared with the control, for the three adhesive proteins tested, indicating that RDD may interfere with cell adhesion but not block integrin-mediated cell adhesion. Lower concentrations showed no significant effect (results not shown).
RDD Synthesis by Skeletal Muscle Cells in Vitro and in Vivo.
We evaluated RDD secretion by C2C12 muscle cells in culture, after transient transfection with the plasmids Tet-On and Tet-tTS together with pBiRDDFlag or control pBi. Starting the day of transfection, doxycycline (1 µg/ml) was added daily to the cell culture medium. RDDFlag was detected in the supernatants of day 2 cultures by Western blotting with an anti-Flag antibody (Fig. 4A
, Lane 2). A 10-kDa band was observed, corresponding to the RDDFlag molecular mass, whereas no band appeared in control conditioned medium (Fig. 4A
, Lane 1). In vivo RDD synthesis was evaluated after muscle-targeted gene electrotransfer of pBiRDDFlag or pBi together with Tet-On and Tet-tTS into nude mouse skeletal muscle (tibialis cranialis). After 1 week of doxycycline stimulation, the presence of RDDFlag in muscle extracts was evaluated by Western blotting with anti-Flag antibodies. The expected 10-kDa band was detected (Fig. 4A
, Lane 3) in RDDFlag-treated animals. This band migrated just like the one produced in vitro by the pBiRDDFlag plasmid transfected into C2C12 muscle cells. No band was detected in the control animals (Fig. 4A
, Lane 4). The presence of RDDFlag in the muscle sections was visualized by immunochemical labeling (Fig. 4, B and C)
. This demonstration of transgene expression in the myofibers validated our use of this expression system in this animal model.
|
|
|
| DISCUSSION |
|---|
|
|
|---|
5ß1, a proangiogenic adhesion integrin, and
vß3, an integrin preferentially expressed on angiogenic blood vessel (15
, 16)
, it can be suggested that the functions of these integrins and metargidin may be mutually dependent. This hypothesis led us to explore the action of the metargidin disintegrin domain, RDD, on angiogenesis. RDD synthesized and secreted by E. coli was tested in vitro on endothelial cells derived from large vessels (HUVECs and CPAE cells) or from microcapillaries (HMVEC-d and HMEC-1 cells). RDD antiangiogenic activity was clearly demonstrated in the three-dimensional fibrin gel model. RDD (5 µg/ml) potently inhibited capillary tube formation by 90%. Because capillary formation represents an end result of endothelial cell proliferation, adhesion, and migration, we further examined the effect of RDD on each of these processes. We noticed that RDD strongly affected endothelial cell migration. This assay, previously developed in our laboratory (39)
, enabled the accurate measurement of the CPAE cell front edge migration. RDD inhibited endothelial cell migration in a dose-dependent manner within the range of 210 µg/ml, with cell mobility being completely stopped at a RDD concentration of 10 µg/ml. In contrast, cell adhesion was only moderately affected, regardless of the integrin ligand substrate tested (vitronectin, fibronectin, or fibrinogen), suggesting that RDD action on cell migration is only partially dependent on inhibition of cell adhesion via integrin molecules.
RDD also inhibited endothelial cell proliferation in a concentration-dependent manner. An inhibition of
50% at 5 µg/ml RDD was constantly observed in our experiments using HUVEC, CPAE, or HMVEC-d cell lines. Apparently RDD affects both endothelial cell migration and proliferation, and these dual actions have been reported for other antiangiogenic molecules, such as angiostatin and endostatin (2
, 3
, 42
, 43)
. In addition, we found weak proapoptotic activity for RDD. RDD inhibition of angiogenesis therefore probably results from combined actions on endothelial cell migration, proliferation, and apoptosis.
One of the key mechanisms involved in RDD inhibition was first thought to be related to its integrin-binding domain. On the basis of the critical role of integrins in vascular development and cell survival (25
, 44
, 45)
, therapeutic agents blocking those integrins, expressed by angiogenic endothelial cells, have been tested in several laboratories. Specific reagents targeting
v integrins, such as vitaxin or RGD-based peptides, inhibited tumor-associated angiogenesis in various animal models (18, 19, 20)
and induced endothelial cell apoptosis (25)
. At present, the exact roles of those integrins expressed on endothelial cells during angiogenesis is still unknown, because
v- and ß3-integrin-null mice were found to exhibit enhanced neovascularization (28, 29, 30)
. Recently, Hynes (30)
has suggested that these integrins are negative regulators of angiogenesis and that the antiangiogenic effect of drugs targeting them results from an agonistic rather than antagonistic action. In contrast to
vß3,
5ß1 integrin is unambiguously angiogenic, and an antagonist ligating this integrin was shown to successfully inhibit angiogenesis (46)
. Thus, RDD may exert its action by neutralizing integrin proangiogenic actions and/or increasing integrin inhibitory actions. Moreover, a recent observation showing the colocalization of metargidin with vascular endothelial cadherin (14)
suggests that the antiangiogenic activity of RDD might also be associated with a defect in the formation of cell junctions between endothelial cells. This possibility could represent another mechanism involved in the RDD effect.
The observed multiple inhibitory activities of RDD were not surprising because metargidin is a multifunctional molecule, as suggested by its structure. Metargidin is composed of an active metalloproteinase domain and an intracellular signaling tail separated by a disintegrin domain (13 , 47 , 48) . The interaction of metargidin with integrins expressed on cell membranes suggests that metargidin functions may be dictated by localization or distribution on the cell membrane. This situation would imply that its functions might be regulated by integrins or other, as yet unidentified, metargidin-binding proteins. On other hand, it has been postulated that RDD may most likely affect metargidin functions, e.g., the proteolytic activity of its metalloproteinase domain, by preventing its association with binding proteins. Thus, by blocking metargidin degradation of ECM components, RDD may prevent endothelial cell migration. This hypothesis is in good agreement with the potent inhibitory action of RDD on cell migration. Moreover, RDD may inhibit endothelial cell proliferation by interfering with metargidin intracellular signaling via binding partners of its cytoplasmic domain and/or a related integrin (23 , 47, 48, 49) .
We further evaluated the effect of RDD on angiogenesis-mediated tumor growth and metastasis. The RDD gene inserted in plasmids was electrotransferred into mouse skeletal muscles in a tetracycline-inducible system. This system has been used successfully in many in vivo studies (32
, 35
, 50, 51, 52, 53)
. We recently demonstrated that the in vivo expression of the transgene in this model was rapid, stable, and tightly regulated (32)
. Moreover, protein was detected in the blood (
50 ng/ml) and could last more than 2 months (32)
. Our present results show that RDD production in vivo inhibited s.c. MDA-MB-231 tumor growth by 78% at day 14 after transgene induction and that this was associated with significantly less tumor vascularization. In addition, in the presence of RDD, 74% fewer B16F10 melanoma metastatic nodules formed in mouse lungs after 1 week of treatment.
Although the precise mechanisms involved in these effects require further investigation, the results of this study demonstrate the antiangiogenic and anticancer activities of RDD. These results are in good agreement with recent data showing the involvement of ADAM-15 in pathological neovascularization in knockout mice (54)
. It is reasonable to postulate that the human RDD used in this study might affect angiogenesis and tumor metastasis through
vß3 and
5ß1 in vivo. Nevertheless, the disintegrin domain of mouse metargidin differs from that of human metargidin because it has a TDD sequence instead of RGD (55)
. Thus, mouse metargidin interacts with
9ß1 instead of
vß3 and
5ß1 (17)
. Therefore, it will be very interesting to investigate the effect of mouse RDD in vivo in comparison with human RDD.
Disintegrins derived from snake venom, such as rhodostomin, accutin, and salmosin, have already been shown to have important inhibitory effects on angiogenesis (56, 57, 58) and on metastatic properties of melanoma cells (59 , 60) . Compared with those disintegrin, RDD has the singular advantage of being the first endogenous disintegrin molecule of human origin and, hence, might avoid immunogenic side effects from the point of the view of future clinical settings. We believe that further investigations will support the potential clinical use of RDD as a potent and promising anticancer agent.
| ACKNOWLEDGMENTS |
|---|
| FOOTNOTES |
|---|
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
Note: V. Trochon-Joseph and D. Martel-Renoir contributed equally to the manuscript.
Requests for reprints: He Lu, U553 INSERM, Hôpital Saint-Louis, 1, av. Claude Vellefaux, 75475 Paris Cedex 10, France. Phone: (33) 1 53 72 40 26; Fax: (33) 1 53 72 40 27; E-mail: helu{at}chu-stlouis.fr
Received 10/27/03. Revised 12/12/03. Accepted 1/ 9/04.
| REFERENCES |
|---|
|
|
|---|
3 chain of type IV collagen inhibits proliferation of melanoma cells. J Biol Chem, 272: 20395-401, 1997.
vß3 integrin binding sites on tumstatin regulate distinct anti-tumor properties. J Biol Chem, 275: 23745-50, 2000.
vß3. J Biol Chem, 273: 7345-50, 1998.
vß3 and
5ß1 integrins on different haemopoietic cells. J Cell Sci, 112: 579-87, 1999.[Abstract]
9ß1 to the ADAM-12 and -15 disintegrin domains mediates cellcell interaction. J Biol Chem, 275: 34922-30, 2000.
vß3 antagonists promote tumor regression by inducing apoptosis of angiogenic blood vessels. Cell, 79: 1157-64, 1994.[CrossRef][Medline]
vß3 prevents maturation of blood vessels during embryonic neovascularization. J Cell Sci, 108: 2655-61, 1995.[Abstract]
v integrin antagonists: comparative anti-cancer efficacy with known angiogenesis inhibitors. Anticancer Res, 19: 959-68, 1999.[Medline]
v integrins. Science, 270: 1500-2, 1995.
v integrins during angiogenesis. Cancer J, 6: 245-9, 2000.
v integrins. Cell, 95: 507-19, 1998.[CrossRef][Medline]
5ß1 with the central cell-binding domain of fibronectin. Am J Pathol, 156: 1345-62, 2000.
vß3 blockade of endothelial cells. Mol Pharmacol, 59: 1333-42, 2001.
vß3 antagonist and inducing apoptosis. Blood, 92: 3268-76, 1998.This article has been cited by other articles:
![]() |
B. Xie, J. Shen, A. Dong, M. Swaim, S. F. Hackett, L. Wyder, S. Worpenberg, S. Barbieri, and P. A. Campochiaro An Adam15 amplification loop promotes vascular endothelial growth factor-induced ocular neovascularization FASEB J, August 1, 2008; 22(8): 2775 - 2783. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. J. Najy, K. C. Day, and M. L. Day The Ectodomain Shedding of E-cadherin by ADAM15 Supports ErbB Receptor Activation J. Biol. Chem., June 27, 2008; 283(26): 18393 - 18401. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. Charrier-Hisamuddin, C. L. Laboisse, and D. Merlin ADAM-15: a metalloprotease that mediates inflammation FASEB J, March 1, 2008; 22(3): 641 - 653. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. L. Zhong, Z. Poghosyan, C. J. Pennington, X. Scott, M. M. Handsley, A. Warn, J. Gavrilovic, K. Honert, A. Kruger, P. N. Span, et al. Distinct Functions of Natural ADAM-15 Cytoplasmic Domain Variants in Human Mammary Carcinoma Mol. Cancer Res., March 1, 2008; 6(3): 383 - 394. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. J. Najy, K. C. Day, and M. L. Day ADAM15 Supports Prostate Cancer Metastasis by Modulating Tumor Cell-Endothelial Cell Interaction Cancer Res., February 15, 2008; 68(4): 1092 - 1099. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Korn, S. Rohrig, S. Schulze-Kremer, and U. Brinkmann Common denominator procedure: a novel approach to gene-expression data mining for identification of phenotype-specific genes Bioinformatics, June 1, 2005; 21(11): 2766 - 2772. [Abstract] [Full Text] [PDF] |
||||
![]() |
L. Charrier, Y. Yan, A. Driss, C. L. Laboisse, S. V. Sitaraman, and D. Merlin ADAM-15 inhibits wound healing in human intestinal epithelial cell monolayers Am J Physiol Gastrointest Liver Physiol, February 1, 2005; 288(2): G346 - G353. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Cancer Research | Clinical Cancer Research |
| Cancer Epidemiology Biomarkers & Prevention | Molecular Cancer Therapeutics |
| Molecular Cancer Research | Cancer Prevention Research |
| Cancer Prevention Journals Portal | Cancer Reviews Online |
| Annual Meeting Education Book | Meeting Abstracts Online |