Cancer Research Infection and Cancer: Biology, Therapeutics, and Prevention  09 AM Call for Abstracts
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Supplementary Data
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Talos, F.
Right arrow Articles by Moll, U. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Talos, F.
Right arrow Articles by Moll, U. M.
[Cancer Research 65, 9971-9981, November 1, 2005]
© 2005 American Association for Cancer Research


Experimental Therapeutics, Molecular Targets, and Chemical Biology

Mitochondrially Targeted p53 Has Tumor Suppressor Activities In vivo

Flaminia Talos, Oleksi Petrenko, Patricio Mena and Ute M. Moll

Department of Pathology, Stony Brook University, Stony Brook, New York

Requests for reprints: Ute M. Moll, Department of Pathology, Stony Brook University, Stony Brook, NY 11794-869. Phone: 631-444-2459; Fax: 631-444-3424; E-mail: umoll{at}notes.cc.sunysb.edu.


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Complex proapoptotic functions are essential for the tumor suppressor activity of p53. We recently described a novel transcription-independent mechanism that involves a rapid proapoptotic action of p53 at the mitochondria and executes the shortest known circuitry of p53 death signaling. Here, we examine if this p53-dependent mitochondrial program could be exploited for tumor suppression in vivo. To test this, we engage Eµ-Myc transgenic mice, a well-established model of p53-dependent lymphomagenesis. We show that exclusive delivery of p53 to the outer mitochondrial membrane confers a significant growth disadvantage on Eµ-Myc–transformed B-cells of p53-deficient or alternate reading frame–deficient genotypes, resulting in efficient induction of apoptosis and impinged proliferation. Conversely, normal cells from thymus, spleen, and bone marrow showed poor infectivity with these viruses. This proof-of-principle experiment shows that exclusive reliance on the direct mitochondrial program exerts a significant tumor suppressor activity in vivo. Our in vivo data on the direct mitochondrial apoptotic p53 program lays the groundwork to further investigate its efficacy and safety and to address its possible therapeutic value in the future.


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The basis of the apoptotic and tumor suppressor p53 activities lies in its pleiotropic action, involving transcription-dependent and transcription-independent functions (1). Previous studies showed that p53 responds to a broad range of death stimuli by rapid stabilization and activation, and mediates cell death primarily via the mitochondrial pathway. Thus, p53 acts as a transcription factor of proapoptotic target genes, such as PUMA, Noxa, Bax, Bid, and p53AIP1, which all reside and/or act at the mitochondria (28).

Aside from its nuclear function, we previously described a direct apoptotic p53 program at the mitochondria. In response to various death stimuli, such as genotoxic drugs, {gamma}-irradiation, and hypoxia, a fraction of induced wild-type p53 protein rapidly (within 30-60 minutes) translocates to mitochondria in primary, immortal, and transformed cells in culture (1, 9, 10). Moreover, induced p53 can physically interact with and form inhibitory complexes with antiapoptotic Bcl-xL and Bcl2 proteins via its p53 DNA-binding domain (1). Mitochondrial p53 induces Bak oligomerization, permeabilizes the outer mitochondrial membrane, and promotes the release of cytochrome c, leading to caspase-3 activation and cell death (1). Of note, this direct mitochondrial p53 program participates in the physiologic p53 response after DNA damage in vivo in normal mice (11). However, tumor-derived missense p53 mutants concomitantly lose or compromise their ability to interact with Bcl-xL and to promote cytochrome c release. Therefore, such mutants may represent "double hits," eliminating the transcriptional as well as the direct mitochondrial function of p53 (1). Together, this suggests that the mitochondrial pathway can participate in tumor suppression in vivo.

Importantly, in p53-deficient cancer cell lines in vitro, mitochondrial targeting of p53 at least partly phenocopies nuclear p53 function in cell killing. Although mitochondrially targeted p53 bypasses the nucleus, it is sufficient to launch effective apoptosis and colony suppression directly from this platform (1, 9). Here, we test this novel pathway in vivo. We show as a proof-of-principle that p53 that has been deliberately excluded from the nucleus and targeted to the outer mitochondrial membrane efficiently kills primary lymphoma cells in mice and thus contributes to suppression of tumorigenesis in vivo.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Retroviral constructs. The replication-defective mouse stem cell virus MSCV-GFP-Bla was constructed by cloning green fluorescent protein (GFP) fused with blasticidine S-deaminase (provided by M. Hayman, State University of New York, Stony Brook, NY) downstream of the polylinker in the MSCV backbone. The expression of GFP-Bla is driven by a separate cytomegalovirus (CMV) promoter. The following cDNAs were subcloned into this vector at EcoRI/NotI sites: human wild-type p53 (Nuclp53) or p53R175H (Nuclp53R175H; see Table 2); human wild-type p53 fused at its COOH terminus to the transmembrane domain of Bcl-xL (p53CTB) or Bcl2 (p53CTM), respectively; or to the endoplasmic reticulum leader sequence of cytochrome b5 (p53ER). As an additional control to rule out nonspecific effects of the transmembrane domain of BclXL, enhanced GFP (EGFP) fused at its COOH terminus to the transmembrane domain of Bcl-xL (peptide sequence SRKGQERFNRWFLTGMTVAGVVLLGSLFSRK) was subcloned into the same vector (EGFP-TMBcl-xL). Retroviral stocks were produced in PhoenixE cells.


View this table:
[in this window]
[in a new window]
 
Table 2. Lack of in vivo killing of lymphoma cells expressing human mutant p53

 
Cells and tissue culture. p53–/– alternate reading frame (ARF)+/+ and p53+/+ ARF–/– Eµ-Myc lymphomas were harvested from tumor-bearing lymph nodes of transgenic mice (C57BL/6-TgMyc). All animal studies were approved by the Stony Brook University Institutional Review Board. Independent isolates derived from six mice were used. Cell suspensions were plated on mitomycin-arrested NIH3T3 feeders and grown in 45% Iscove's medium, 45% Dulbecco's medium, and 10% fetal bovine serum (FBS) before spinocculation. Aliquots of cells were treated with Adriamycin (0.34 µmol/L) for the indicated times in some experiments.

Mouse embryonic fibroblasts (MEFs) were prepared from 14.5-day embryos (C57BL/6). p53–/– MEFs were derived from Trp53tm1Tyj mutant mice. ARF–/– MEFs were a gift from C. Sherr (Department of Biochemistry, St. Jude Children's Research Hospital, Memphis, TN). MEFs and NIH3T3 were maintained in DMEM plus 10% FBS. In vitro growth of infected lymphoma cells was measured by plating equal numbers in triplicate on equal numbers of feeders, with daily counting of nonadherent cells by Coulter counter and fluorescence-activated cell sorting (FACS). For in vitro apoptosis studies, samples were initially adjusted to 65% of GFP-positive cells. For lymphoma cells, terminal deoxynucleotidyl transferase–mediated nick end labeling (TUNEL; Roche, Nutley, NJ) was done 36 hours after transduction without additional DNA damage. Apoptosis was quantified by calculating the fold increase over vector in the proportion of red cells that were also green (TUNEL/GFP) from three representative images, using the Automatic Measurement Program of AxioVision v4.3. This software tool analyzes the total area pixel intensities and densities of a color per image.

For MEFs, E1A-sensitized cells were retrovirally transduced, then selected in blasticidine for 4 days to obtain 100% GFP positivity and either left untreated or treated with adriamycin (0.34 µmol/L) for the indicated times.

Cells from normal bone marrow, spleen, and thymus were harvested from C57BL/6 mice, put into culture on 3T3 feeder layers, and spinoculated thrice with 8-hour interval, starting on the same day. GFP expression was quantitated by FACS on days 2, 4, 6, and 8 postinfection. Parallel cultures were immunnophenotyped by FACS using the following cell markers: B220 (CD45R), IgM, MAC1{alpha} (CD11b), Thy1 (CD90), and erythroid marker TER-119 (all from BD PharMingen, San Diego, CA).

Protein expression. Whole cell lysates (50-70 µg) were immunoblotted with antibodies specific for p53 (mouse-specific CM-5, Vector, Burlingame, CA; human-specific DO-1 and mouse and human specific Pab 421, Calbiochem, San Diego, CA); p21 (SXM30, PharMingen), PUMA (AbCam, Cambridge, MA); p19ARF (Ab80-50, AbCam); p21 (F5), MDM2 (SMP14), BclXL/xs (S18), E1A (135-5), cleaved caspase-3 (Asp175, does not cross-react with procaspase-3; Cell Signaling Technology) and proliferating cell nuclear antigen (PCNA; all from Santa Cruz Biotechnology, Santa Cruz, CA).

Immunofluorescence. Lymphoma cells were cytospun onto slides; 3T3 cells were grown in eight-well chamber slides. Cells were fixed in 4% paraformaldehyde for 20 minutes and permeabilized with PBS/0.5% Tween 20 for 5 minutes. Slides were blocked in 10% normal goat serum, followed by 2 hours incubation with CM-1 (1:500; human specific p53; Vector) and either cytochrome c (1:200; clone 2G8, gift of R. Jemmerson, Department of Neurosciences, University of Minnesota, Minneapolis, MN) or mt hsp70 (1:25; ABR Affinity Bioreagents, Golden, CO) to detect mitochondria. For p53ER, p53 was detected with DO-1 and endoplasmic reticulum was detected with anticalreticulin (ABR Affinity Bioreagents). Anti-mouse IgG and anti-rabbit IgG were used for controls. Slides were incubated in Cy5- and tetramethylrhodamine isothiocyanate–conjugated secondary antibodies for 1 hour. Cells were viewed in a confocal laser microscope (Zeiss LSM 510). Tumor sections were stained with DO-1 by immunoperoxidase.

Mitochondrial membrane potential. To measure mitochondrial membrane potential as an indicator of mitochondrial dysfunction, freshly transduced whole cells were incubated in 300 nmol/L Mitotracker Red CMXRos (Molecular Probes, M-7512) added to the culture for 30 minutes at 37°C, washed, and analyzed by FACScan. For each curve, 10,000 GFP-positive events were acquired.

In vivo competition experiments. Three protocols using GFP-positive ratios of 40:60, 75:25, and 90:10 were used as described in Results. FACS-sorted cells were cultured for 3 days before injection to verify sterility. Lymphoma cells (1 x 106) in 100 µL PBS were injected into the tail vein of syngeneic, nontransgenic recipient mice. After 26 to 30 days, animals had developed palpable lymphomas in the cervical and/or inguinal, axillary, and retroperitoneal regions. Occasionally, extranodal lymphomas were seen. Tumors from each recipient were pooled and analyzed by flow cytometry to determine residual GFP expression. To verify histopathology, each tumor was processed for H&E. In no case were inflammatory lymphocytic infiltrates within or around the tumors observed. Likewise, damage of normal tissue components, including vasculature and stroma, was not present. For apoptosis assays in vivo, lymphomas were fixed and stained by TUNEL with Hoechst counterstaining. Alternatively, 2 x 106 transduced lymphoma cells were injected s.c. into normal syngeneic mice and animals sacrificed 2, 4, 8, and 12 days later. Injection sites were harvested and processed for TUNEL/H&E and p53 immunoperoxidase staining with DO-1.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
p53CTB and p53CTM target to mitochondria. We and others recently reported that a fraction of induced p53 translocates to the mitochondria of apoptosing tumor cells (9, 12). Moreover, targeting p53 to mitochondria using mitochondrial import leader fusions is sufficient to launch apoptosis in p53-deficient cells (1). To determine if mitochondrially targeted p53 retains its proapoptotic and tumor-suppressive properties in vivo, we generated a series of murine stem cell viruses expressing GFP and either conventional nuclear p53 (Nuclp53) or two versions of mitochondrially targeted p53 (p53CTM and p53CTB). Control virus lacked p53 inserts (Fig. 1A). p53CTM is a COOH-terminal fusion of human wild-type p53 with the transmembrane domain of Bcl2. We previously showed that p53CTM fails to localize to the nucleus but instead targets primarily to mitochondria and promotes apoptosis and colony suppression in p53 null human cancer cells (1). p53CTB is a COOH-terminal fusion of human wild-type p53 with the transmembrane domain of Bcl-xL. Native Bcl-xL is a resident mitochondrial protein and specifically localizes to the mitochondrial outer membrane in unstressed and stressed cells (13, 14). Mitochondrial localization of Bcl-xL is exclusively mediated by the COOH-terminal transmembrane domain (14).



View larger version (42K):
[in this window]
[in a new window]
 
Figure 1. Characterization of lymphoma isolates used in in vitro and in vivo studies. A, general scheme of murine stem cell virus MSCV-p53 CMV-GFP-blasticidine. p53 inserts were either nuclear human wild-type p53 (Nuclp53) or the tumor-derived R175H mutant (Nuclp53 R175H), or human wild-type p53 fused at the COOH terminus to the transmembrane domain of human BclXL (p53CTB) or Bcl2 (p53CTM), respectively. The control virus lacked the p53 insert. For another control, EGFP was fused at its COOH terminus to the isolated transmembrane domain of BclXL (EGFP-TMBclXL). B and C, similar expression levels among the various p53 constructs. Retrovirally driven expression of nuclear and mitochondrially targeted p53 in NIH3T3 cells (B) and in p53 null and ARF null primary lymphoma cells (D). Immunoblot analysis for p53. PCNA was used as loading control. D, transduced levels of targeted p53 do not exceed the physiologic range. Endogenous p53 protein levels of ARF null lymphomas after adriamycin (0.34 µmol/L for 4 hours) are higher than transduced levels of p53CTM and p53CTB in p53 null lymphomas. Immunoblot for p53 using the mouse and human p53-specific monoclonal antibody PAb 421. The fusion proteins migrate slightly slower. PCNA was used as loading control. E, viral transduction efficiencies of cells shown in (D), as determined by coexpressed GFP marker via FACS analysis 48 hours after transduction. A representative set with p53 null lymphoma cells is shown. Similar efficiencies were obtained with ARF null cells. Uninfected parental cells were used to calibrate the FACS instrument for the M2 region. After adjustment to a 40:60 ratio with parental cells, these cells were then immediately injected into nontransgenic recipient mice.

 
In primary p53-deficient or ARF-deficient lymphoma isolates (examples in Supplementary Fig. S1; subsequently also used in vivo) as well as in NIH3T3 cells, protein levels of transduced Nuclp53 were similar to levels of transduced p53CTM and p53CTB (Fig. 1B and C). Moreover, the GFP intensity profiles in transduced p53-deficient or ARF-deficient lymphoma cells were very similar between empty vector, Nuclp53, p53CTM, and p53CTB (M2 region in Fig. 1E; data not shown). This indicates that targeted p53 does not affect the level of GFP expression in a manner different from nuclear p53, thus validating GFP as a readout for cell survival. Of note, transduced levels of targeted p53 were within physiologic range because protein levels of p53CTM and p53CTB in p53 null lymphomas were actually lower than endogenous p53 levels in ARF null lymphomas stressed with adriamycin (Fig. 1D). Moreover, p53CTB and p53CTM levels are comparable with the stress-induced endogenous p53 levels of normal irradiated thymocytes (Supplementary Fig. S2). Flow cytometric examination of cells showed that infection efficiency was around 40% for all constructs, as indicated by GFP positivity (Fig. 1E). Localization studies showed that in contrast to the nuclear localization of transduced wild-type p53 (Supplementary Fig. S3), p53CTB localized exclusively to mitochondria in several cell types (MEF, NIH3T3 cells, and human H1299 carcinoma cells; Fig. 2). p53CTM exhibited a predominant mitochondrial localization (Supplementary Fig. S4A) plus some minor localization to endoplasmic reticulum (Supplementary Fig. S4B) consistent with native Bcl2 localization (14). To rule out that the small endoplasmic reticulum–localized subfraction of p53CTM contributes to apoptosis, we deliberately targeted p53 to the endoplasmic reticulum by replacing the Bcl2 domain with the endoplasmic reticulum leader sequence of cytochrome b5. As expected, in contrast to p53CTB and p53CTM, p53ER lacked any apoptotic ability in p53 null H1299 and SaOS-2 cells, indicating that the apoptotic ability of p53CTM is solely due to its mitochondrial action (Supplementary Fig. S4C).



View larger version (24K):
[in this window]
[in a new window]
 
Figure 2. p53CTB targets to mitochondria. Immunofluorescence analysis. p53CTB (stained in red with human p53 specific antibody CM-1) colocalizes with cytochrome c (stained in blue with anticytochrome c antibody 2G8). No nuclear staining is detectable. Transduced cells are marked by GFP. 3T3 cells are shown. Identical results were obtained in lymphoma cells and H1299 cells. Retrovirally expressed Nuclp53 shows a nuclear distribution.

 
Mitochondrially targeted p53 lacks transcriptional activity. p53CTB and p53CTM proteins were undetectable in nuclei of all cells tested, including MEFs, NIH3T3, and H1299 cells (Fig. 2; Supplementary Fig. S4A and B and data not shown). To definitively rule out residual transcriptional activity of these proteins, we analyzed their ability to induce endogenous target genes of the apoptotic and arrest category. In contrast to stressed endogenous p53 in wild-type MEFs or retrovirally transduced wild-type p53, p53CTM and p53CTB were unable to induce p21Waf1, PUMA, or Bid in p53 null MEFs irrespective of the absence or presence of Adriamycin (Fig. 3A; data not shown). More importantly, p53CTM and p53CTB also lacked transcriptional activity in p53 null lymphoma cells, as indicated by lack of induction of p21Waf1, PUMA, Bax, and MDM2 even after further challenge by adriamycin. In contrast, ARF null lymphoma cells, which harbor endogenous wild-type p53 that is fully functional for a DNA damage response (as opposed to oncogenic challenge), induce these target genes (Fig. 3B; data not shown). Parenthetically, p53CTM/CTB—but not vector-transduced lymphomas—also showed increased levels of Bcl-xS isoforms, proapoptotic alternate splice products of the Bcl-X gene, a marker for activation of the mitochondrial death pathway (Supplementary Fig. S5A; refs. 15, 16). Thus, p53CTM/CTB expression in lymphoma cells induces an altered splicing ratio between Bcl-xL and Bcl-xS in favor of xS, and this contributes to mitochondrial dysfunction. We had also shown previously that p53CTM formed specific complexes with Bcl-xL and promoted apoptosis and colony suppression of SaOs2 cells (1). To further show the negative effect of p53CTB and p53CTM on mitochondrial function, we measured the mitochondrial membrane potential of freshly transduced p53 null lymphoma cells, using the well-established FACS analysis of cells stained with the potentiometric dye Mitotracker Red CMXRos (Supplementary Fig. S5B). We observed that the p53CTB and p53CTM curves were shifted to the right in a highly reproducible manner compared with vector alone, indicating hyperpolarization of the mitochondrial membranes of p53CTB- and p53CTM-transduced cells. Hyperpolarization of the mitochondrial membrane is one of the early markers of mitochondrial dysfunction (17). Together, these data strongly suggest that any apoptotic activity of p53CTB/CTM that we might see in subsequent experiments in vivo is due to their direct action at the mitochondria and not due to a cryptic transcription-dependent p53 function.



View larger version (48K):
[in this window]
[in a new window]
 
Figure 3. Mitochondrially targeted p53 proteins lack transcriptional activity. A, p53–/– MEFs were transduced with empty vector, p53CTM, or p53CTB and either left untreated or treated with 0.34 µmol/L adriamycin for the indicated times. Uninfected wild-type MEFs are the positive control. Immunoblot analysis for p53, p21Waf1, and PUMA. B, p53–/– lymphoma cells (isolate 5) were transduced with empty vector, p53CTM, or p53CTB to 65% GFP positivity and left untreated or treated with 0.34 µmol/L adriamycin for the indicated times. Wild-type p53 harboring ARF null lymphoma cells were used as positive control. Immunoblot analysis for p53, p21Waf1, PUMA, Bax, and MDM2 (not shown). PCNA was used as loading control in (A) and (B).

 
Mitochondrially targeted p53 promotes apoptosis in primary lymphoma in vitro. To show apoptotic activity of targeted p53, we first analyzed the killing ability of p53CTB and p53CTM in vitro on primary MEFs and lymphoma isolates. Wild-type, p53 null, and ARF null MEFs were presensitized to cell death by retroviral transduction with E1A. After treatment with Adriamycin for 6 or 12 hours, mitochondrial p53CTB and p53CTM proteins increased apoptosis by ~2- to 3-fold in all three genotypes, compared with vector alone (Fig. 4A; Supplementary Fig. S6).



View larger version (63K):
[in this window]
[in a new window]
 
Figure 4. Mitochondrial p53 promotes apoptosis in vitro. A, wild-type MEFs, p53–/– MEFs, and ARF–/– MEFs (all 129xBL6 genotype; passages 3-5) were sensitized by transduction with E1A-encoding retroviruses. Subsequently, cells were transduced with empty vector, p53CTM, or p53CTB and enriched to 100% purity for 3 days in blasticidine. Cells were then treated with 0.34 µmol/L adriamycin for 6 or 12 hours or left untreated, and TUNEL assays were done. B, primary p53 null lymphoma cells, 72 hours after infection with the indicated viruses, were further enriched to >90% GFP positivity by FACS sorting, immediately followed by TUNEL assay. Alternatively, cells were enriched to >90% GFP positivity by blasticidine selection for 2 more days before TUNEL assay. Representative images of one of three independent experiments are shown. The average fold increase compared with vector is indicated on the left. C and D, mitochondrially targeted p53 restrains growth in long-term culture. p53 null lymphoma cells were infected with the indicated viruses and maintained in culture for 25 days. The percentage of cells that retained expression of the transfected genes was determined by GFP via FACS. D, Mean ± SD from three independent experiments. The Nuclp53 samples had negligible error. C, example of raw FACS data used to generate the graph in (D), indicating a drop in GFP intensity over time in p53 null lymphoma cells infected with p53CTM virus.

 
Likewise, in p53 null lymphoma cells, short-term expression of p53CTM and p53CTB alone, in the absence of any DNA damage, increased apoptosis by 5.2- and 5.4-fold on average, respectively, over empty virus, as indicted by TUNEL assays, albeit this effect was somewhat weaker than that seen with nuclear wild-type p53 (5.8-fold; Fig. 4B and Supplementary Table S1). These levels of apoptosis seen by TUNEL (compared with empty vector) were also supported by mild differences in the levels of cleaved caspase-3, as shown by immunoblot analysis (Supplementary Fig. S5C).

When assayed over a period of 25 days in growth competition assays, the numbers of p53CTM- and Nuclp53-infected lymphoma cells both sharply declined. In contrast, control cells transduced with empty virus or EGFP-TM Bcl-xL (also called GFPCTM) dropped only slightly (Fig. 4C and D). On the other hand, cell cycle analysis by FACS showed no evidence for an antiproliferative effect of p53CTM expression in these cells (data not shown). Together, this indicates that mitochondrially targeted p53 leads specifically to lymphoma cell apoptosis rather than to a general cytotoxic effect.

Mitochondrially targeted p53 mediates tumor suppression in primary lymphomas in vivo. Eµ-Myc transgenic mice overexpress the c-myc oncogene in their B-cell lineage and develop pre-B and B-cell lymphomas within 4 to 6 months of age (18). This well-established transplantable tumor model has many advantages. Most importantly, test genes can be efficiently introduced ex vivo by retroviral gene transfer into isolated primary lymphoma cells and injected into the tail vein of normal syngeneic recipient mice for lymphoma reconstitution. Tumor formation and aggressiveness depends on a disabled p53 pathway (1924). Tumor apoptosis occurs via the mitochondrial pathway because Bcl2, which is not overexpressed in these lymphomas, produces multidrug resistance when forcibly overexpressed (20). In murine fibroblasts and lymphoid cells, loss of p53 is equivalent to loss of INK4a/ARF, the positive upstream regulator of p53, and both events greatly accelerate c-myc lymphomagenesis (19). Compared with parental tumors, p53- null and ARF null lymphomas are highly invasive with severe apoptotic defects and marked resistance to chemotherapy (19). We isolated several independent primary lymphomas (four tumors of genotype p53–/– ARF+/+ and two tumors of genotype ARF –/– p53+/+) from p53+/– and ARF+/– Eµ-Myc mice. After 2 days in culture, isolates were transduced with MSCV-GFP control virus or viruses expressing nuclear or mitochondrially targeted p53 (Supplementary Fig. S7). After 36 to 48 hours, these cells were then immediately injected into the tail veins of syngeneic normal recipient mice to assess the effect of mitochondrially targeted p53 on tumor burden in vivo. In the context of p53 null lymphomas, this model provides a quantitative measure whether mitochondrial p53, as the sole source of cellular p53, has efficient tumor killing actions in vivo to cause tumor suppression at natural sites. Thus, the rapidly reconstituted lymphomas in the recipient mice differed only by the presence or absence of p53 proteins (20). Importantly, mouse and human p53 are functionally completely interchangeable in vivo, because knock-in mice harboring the human p53 DNA-binding domain within a mouse gene backbone develop normally, show wild-type p53 responses to DNA-damaging agents and have wild type–like tumor suppression (25). Moreover, as shown in Fig. 2, human p53 fusion proteins expressed in mouse cells target properly to mitochondria.

All experiments were done as in vivo competitions between transduced and parental cells using three different protocols. In the first protocol, 40% of freshly transduced p53 null lymphoma cells, confirmed for GFP positivity at 36 hours (see Fig. 1E), were mixed with 60% GFP-negative parental lymphoma cells and immediately injected into recipients (1 x 106 per mouse). Four weeks later, all reconstituted tumors from a given recipient were pooled and their residual GFP positivity determined by FACS (Table 1; examples in Fig. 5A). Eighteen mice injected with 40% empty virus-GFP yielded 30.8 ± 18% residual GFP-positive tumors, reflecting the ability of vector-transduced cells to survive in the bloodstream and proportionally contribute to lymphoma reconstitution. In sharp contrast, each of 12 control mice injected with 40% Nuclp53-expressing cells yielded 0% residual GFP positivity. Of note, the 13 mice receiving 40% p53CTM-GFP–expressing cells yielded tumors with only 0.4 ± 1.0% residual GFP-positive cells. The individual tumor GFP-positive scores of the p53CTM group were 0%, 0%, 0%, 0%, 0%, 0%, 0%, 0%, 0%, 0%, 0.6%, 1.5%, 3.5%, respectively (P < 0.0005 compared with empty virus group). An additional single mouse yielded tumors with 34% residual GFP positivity but analysis indicated that it expressed a functionally inactive p53 (see Supplementary Fig. S8A). Likewise, four mice injected with 40% p53CTB-GFP–expressing cells yielded tumors without detectable residual green cells (individual GFP scores were 0%, 0%, 0%, and 0%; P < 0.0005). Thus, 82% (14 of 17 mice) of reconstituted p53CTM/CTB tumors were completely (0%) and 18% (3 of 17 of mice) almost completely (0.6-3.5%) devoid of tumor cells expressing mitochondrially targeted p53. Instead, these tumors were composed of surviving parental cells. Together, this indicates that lymphoma cells expressing mitochondrial p53 as their sole source of p53 are at a significant growth disadvantage and undergo dramatic tumor suppression in vivo, which is nearly as efficient as the suppression achieved with nuclear p53.


View this table:
[in this window]
[in a new window]
 
Table 1. In vivo cell death of p53 null B cells expressing mitochondrially targeted p53

 



View larger version (136K):
[in this window]
[in a new window]
 
Figure 5. A, mitochondrially targeted p53 kills primary lymphoma cells in vivo. Representative examples of FACS analyses of residual GFP expression in reconstituted lymphomas at day 28. Tumors were generated by tail vein injections of primary p53 null lymphoma cells (1 x 106) containing 40% virally transduced cells into nontransgenic recipients. Two representative animals each are shown. The uninfected parental cells served to calibrate the FACS instrument. Corresponding H&E sections confirm the histopathology of large cell lymphoma with severe nuclear atypia and apoptotic bodies. B and C, kinetics of mitochondrial p53-induced apoptosis in vivo. B, 12-day lymphomas generated by injection of transduced p53 null cells (1 x 106) into the dorsal skin of nontransgenic mice. A mixture of 85% transduced (after FACS sorting) and 15% parental cells were injected. In situ tumor growth is shown by H&E staining, apoptotic activity is monitored by TUNEL staining, and residual p53CTM- and p53CTB-expressing lymphoma cells are identified by p53 immunoperoxidase staining with DO-1. Brisk apoptotic activity was seen in p53CTM and p53CTB tumors. C, example of a reconstituted lymphoma in a cervical lymph node harvested 28 days after tail vein injection of 90% transduced and 10% parental p53 null lymphoma cells. At that late time, terminal p53CTM and p53CTB tumors are "burnt out." They have largely depleted their p53-expressing cell populations and, thus, are predominantly composed of uninfected competitor cells. Hence, FACS determination showed that this terminal p53CTM tumor contained only 2% residual GFP-positive cells.

 
Competition protocols using higher proportions of transduced versus parental lymphoma cells confirmed the in vivo killing ability of mitochondrially targeted p53. Transduced cells were either drug selected or FACS sorted before injection to obtain a higher percentage than could be achieved by transduction alone. In the 75:25 protocol, transduced p53 null cells were first preselected in blasticidine for 4 to 10 days (Table 1). This quickly eliminates cells with high p53 expression and enriches for cells with low expression that are able to survive longer in culture. Once in vivo, these cells probably receive additional physiologic stress signals that trigger their apoptosis. Mixtures of 75% transduced and 25% parental cells were injected into normal recipients. Three mice injected with 75% vector-GFP cells yielded tumors with 44.3 ± 3% GFP positivity, reflecting a decreased but still strong ability of these cells to contribute to lymphomas. The positive control animal injected with 75% Nuclp53-GFP cells generated 12% residual GFP positivity. Further analysis, however, showed that this particular tumor had selectively lost p53 expression, likely due to rearrangement of the retroviral p53 region, which explained the relatively high numbers of surviving GFP-positive cells (Supplementary Fig. S8B). The 11 mice injected with 75%: 25% p53CTM-GFP cell mixtures yielded tumors containing only 1.1 ± 0.1% residual GFP positivity (P < 0.0005 compared with empty virus), confirming the p53CTM result seen in the 40:60 protocol. It should be noted, however, that the low fluorescence of p53CTM-transduced cells is difficult to interpret as it might result from autofluorescence rather than from retrovirally transduced GFP.

In the third protocol, transduced cells at their peak expression at 48 hours postinfection were FACS sorted by GFP to >99% purity. Sorted cells were mixed with parental cells at a 90:10 ratio and immediately injected into recipients. Consistent with our previous results, 14 control mice injected with 90% vector-GFP–infected cells produced tumors with 70 ± 10% GFP positivity, whereas seven mice injected with 90% p53CTM-transduced cells produced tumors averaging only 14 ± 14% residual GFP positivity (Table 1). The reduction in the p53CTM group was again highly significant (P < 0.0005 compared with empty virus). Of note, the transduced cells injected into the p53CTM group all originated from a single isolate (isolate 5). Reconstituted tumors, however, fell into two subgroups. Tumors from four animals showed the expected strong reduction of p53CTM-expressing cells, with residual GFP scores of 2%, 2%, 3.5% and 5%. Three mice, however, showed only a moderate reduction, with scores of 26%, 28% and 36% GFP positivity. One possible explanation for this bimodal distribution is that parental isolate 5 was genetically heterogeneous and contained a clonal subpopulation that had acquired an additional apoptotic mutation during lymphomagenesis in the donor. This latter clone might have become stochastically dominant in the three animals with relatively high GFP scores, but not in the four animals with low scores. In aggregate, these data clearly confirm that mitochondrially targeted p53, as the sole source of cellular p53, has tumor killing actions in vivo at natural tumor sites. Moreover, this killing action does not require additional radiotherapeutic or chemotherapeutic agents.

Finally, to rule out the remote but formal possibility that the tumor suppression we observed in p53CTB and p53CTM lymphomas was not due to mitochondrial p53-mediated apoptosis but rather due to a nonspecific immune response against human p53 in a mouse background, we used the tumor-derived inactive human mutant p53R175H. As expected, mice injected with a 75:25 ratio of Nuclp53(R175H)-transduced lymphoma cells yielded tumors with 51 ± 18% GFP positivity (n = 6; P < 0.0005 compared with empty virus), confirming that the suppression seen with targeted p53-expressing vectors is specifically mediated by p53CTB and p53CTM (Table 2).

Mitochondrially targeted and nuclear p53 cooperate in tumor suppression. Despite the presence of a wild-type p53 gene, ARF null lymphomas exhibit a severely impaired p53 activity toward oncogenic deregulation (19, 24). To test whether targeted p53 also kills these cells in vivo, two independent ARF null tumor isolates were used in the competitive 40:60 protocol (Supplementary Fig. S1; Table 3). Generally, we found a higher sensitivity to spontaneous and p53-induced cell death in ARF null lymphoma cells compared with p53 null lymphoma cells. Thus, mice injected with 40% empty virus-infected cell mixtures produced reconstituted tumors with 18 ± 13% GFP positivity (n = 14). In contrast, mice injected with 40% p53CTM-expressing cell mixtures produced tumors with only 0.2 ± 0.4% residual GFP positivity (n = 12; P = 0.0001). Moreover, mice injected with 40% p53CTB-expressing cell mixtures produced tumors with only 0.4 ± 0.7% residual GFP positivity (n = 11; P = 0.0001). This result is identical to that from mice injected with Nuclp53-expressing cells (n = 13; 0.6% ± 0.6%). Thus, as in p53 null lymphomas, ARF null lymphomas expressing mitochondrially targeted p53 show a dramatic in vivo suppression. Moreover, in these cells, the mitochondrial p53 program can functionally complement the endogenous p53 program.


View this table:
[in this window]
[in a new window]
 
Table 3. In vivo cell death of ARF null B cells expressing mitochondrially targeted p53

 
Mitochondrially targeted p53 mediates tumor suppression by inducing apoptotic cell death. To obtain in vivo proof of p53 CTB/CTM-induced apoptosis in lymphoma tissues, tumors were assayed by TUNEL staining. We chose an early time point during lymphoma reconstitution, because once tumors have reached a certain size, secondary factors such as necrosis due to insufficient blood supply render interpretation unreliable. To this end, transduced lymphoma cells, sorted to 85% GFP positivity and mixed with 15% parental cells, were s.c. injected into recipient mice to allow easy observation of tumor growth (18). Twelve days later, s.c. sites were harvested and in situ tumor growth was confirmed by H&E staining. As expected, a much higher degree of apoptosis was present in lymphomas generated by p53CTM- and p53CTB-expressing cells, indicated by large numbers of TUNEL-positive cells and apoptotic bodies compared with lymphomas derived from empty virus cells (Fig. 5B). Conversely, at that time point, the p53CTM- and p53CTB-derived lymphomas still contained a viable, albeit drastically decimated (from the initial 85%) subpopulation of mitochondrial p53-expressing tumor cells (Fig. 5B). On the other hand, at 28 days postinjection, the composition of reconstituted lymphomas represented the "winning" cell type at end point, because all mice die from their malignancy within 1 to 3 days if not sacrificed. Thus, at that late time, terminal p53CTM and p53CTB tumors have largely depleted their p53-expressing cell populations and instead were predominantly composed of uninfected competitor cells. Hence, tumors derived from p53CTM/CTB-injected mice have similar low background apoptotic activities as vector tumors because they are "burnt out" (Fig. 5C). Thus, the bulk of mitochondrial p53-driven tumor cell death occurs early in the course of lymphoma reconstitution, likely starting already in the injected circulating cell population before homing into lymph nodes.

Lack of infectivity by p53CTB retrovirus in normal cells. Whereas we successfully used retroviral gene transfer in this animal model, one critical issue with any kind of therapeutic approach aiming at introducing toxic proteins into cancer cells is how to specifically target cancer cells but not normal cells in vivo. Intratumoral injection of recombinant viruses has been the preferred route to maximize transduction of cancer cells and minimize infecting normal cells. To further begin to address this issue directly, we attempted to infect normal cells from young C57BL/6 mice including primary bone marrow cells, splenocytes and thymocytes with the same MSCV-based retroviruses used throughout this study (see Fig. 1A). However, overall, attempts to infect normal thymocytes, splenocytes, and primary bone marrow cells with the same retroviruses used to study the lymphomas were largely unsuccessful. Thus, normal cells and lymphomas behave differently in terms of retroviral transduction. As shown in Supplementary Table S2, wild-type splenocytes and thymocytes were not infectable in two and three independent experiments, respectively. Moreover, >80% of wild-type bone marrow cells were not infectable as indicated by only a small percentage of GFP-expressing cells at peak viral expression on day 4. At day 4, empty vector infected 14% B-lymphocyte–enriched (R2) and 10% macrophage-enriched (R3) fractions, whereas p53CTB infected 8% B-lymphocyte– and 2% macrophage-enriched fractions. Whereas the p53CTB-infected cells in the R3 (macrophage population) clearly persisted, they did not expand, as they did for the vector control R3 and for the vector and p53CTB infected R2- populations. In light of the inconclusive data on the R3-infected cells, we cannot firmly conclude that p53CTB fails to induce death in a small subfraction of normal bone marrow cells. A further indication for low infectivity of normal cells is the fact that we were unable to infect p53 null bone marrow cells with either empty virus or p53CTB. Taken together, the MSCV-based p53CTB virus seems to have absent or low infectivity of normal cells and the small percentage of normal cells that do get infected do not undergo apoptosis. These data is consistent with findings by Bossi et al. (26) that infection of primary bone marrow cells with a retrovirus encoding conventional wild-type p53 does not impair the ability of hematopoietic stem cells to reconstitute the bone marrow compartment of syngeneic, irradiated mice. Furthermore, simultaneous infection of leukemia and bone marrow cells with this retroviral wild-type p53 depleted the neoplastic but not the normal cells, allowing lifelong, disease-free survival of 65% of the transplanted animals. These results show that exogenous wild-type p53 is controlled as tightly as the endogenous one in normal cells (26).


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Abrogation of p53-mediated apoptosis is a fundamental defect in human tumors and promotes chemoresistance; hence, its functional restoration is a premier therapeutic target in a "universal" cancer strategy. As a proof-of principle, we show here that exploiting the shortest known circuitry of p53 death signaling (i.e., the direct transcription-independent mitochondrial p53 death program may have therapeutic potential in the future).

Up to now, efforts focused on restoring transcription-mediated p53 apoptosis. One venue tries to identify small molecules that structurally rescue tumor-derived p53 mutant proteins. Two prototype compounds, CP-31398 and PRIMA-1, can restore transcriptional p53 function in cell-based assays and slow tumor growth in nude mice. However, their mechanism of action is unclear (27, 28) and their in vivo efficacy is untested. Another venue focuses on supplying conventional wild-type p53 via gene therapy (29). Both the wild-type p53 and small molecule approach rely on the preserved ability of tumor cells to respond with transcriptional activation of p53 target genes. However, many human cancers have lost this prerequisite due to global epigenetic deregulation of their genome, leading to broadly aberrant gene silencing patterns (30). Moreover, recent genetic studies showed that at least some p53 mutants with reduced transcriptional activity retain substantial proapoptotic activity in response to various stresses (e.g., p53S15A, p53S23A, p53S389A, p53L25QW26S; refs. 3135). These data support the idea that p53 is able to induce apoptosis in a transcription-independent manner. As a transcription factor, p53 works as a homotetramer mediated via its COOH-terminal domain, which makes the protein vulnerable to dominant negative inhibition by endogenous p53 mutants that are expressed at high levels in cancer tissues. An additional vulnerability for dominant negative interference of ectopic p53 emanates from {Delta}N isoforms of p63 and p73, which are also frequently overexpressed in human cancers (36, 37).

p53-dependent apoptosis mainly uses the intrinsic mitochondrial pathway (38). Importantly, apoptosis relies upon a preassembled death machinery of protein and DNA-degrading enzymes that do not require transcription of new genes. Indeed, apoptosis can be triggered and proceed to its biochemical end point in nuclei-free cytoplasts (3941). Our study shows that transcriptional p53 restoration might be dispensable for tumor killing in vivo. Instead, tumor cell suppression can be achieved by exploiting the direct transcription-independent apoptotic p53 program at mitochondria. With respect to the relative strength in apoptosis induction in vivo, p53CTB and p53CTM resemble Nuclp53 (see Table 1). Mitochondrial p53 uses its DNA-binding domain to inhibit the antiapoptotic BclXL/Bcl2 proteins and to induce BAK and BAX oligomerization and cytochrome c release (1, 4245). Nuclear magnetic resonance studies confirmed that the BclXL interaction surface on p53 involves the same region that is used to contact DNA (44). In addition, mitochondrial p53 can also directly bind and oligomerize proapoptotic BAK (45). However, in contrast to transcriptionally active p53, mitochondrial p53 does not require tetramerization because its COOH-terminal domain is fully dispensable (9). This potentially provides another important advantage in that mitochondrially targeted p53 might escape dominant negative inhibition by endogenous mutant p53 proteins and {Delta}Np63/p73 isoforms in tumors. Together with its transcription independence and potential escape from dominant negative interference, our data suggests the possible therapeutic relevance of targeting p53 to mitochondria, perhaps as a synergistic modality with existing p53-based strategies.


    Acknowledgments
 
Grant support: NIH grant CA060664 and the Philip Morris Extramural Research Grant Program (U.M. Moll).

The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

We thank Scott Lowe for his kind gift of B-lymphoma cell lines.


    Footnotes
 
Note: Supplementary data for this article are available at Cancer Research Online (http://cancerres.aacrjournals.org/).

Received 3/31/05. Revised 8/ 8/05. Accepted 8/16/05.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. Mihara M, Erster S, Zaika A, et al. p53 has a direct apoptogenic role at the mitochondria. Mol Cell 2003;11:577–90.[CrossRef][Medline]
  2. Miyashita T, Kitada S, Krajewski S, Horne WA, Delia D, Reed JC. Overexpression of the Bcl-2 protein increases the half-life of p21Bax. J Biol Chem 1995;270:26049–52.[Abstract/Free Full Text]
  3. Oda E, Ohki R, Murasawa H, et al. Noxa, a BH3-only member of the Bcl-2 family and candidate mediator of p53-induced apoptosis. Science 2000;288:1053–8.[Abstract/Free Full Text]
  4. Oda K, Arakawa H, Tanaka T, et al. p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53. Cell 2000;102:849–62.[CrossRef][Medline]
  5. Nakano K, Vousden KH. PUMA, a novel proapoptotic gene, is induced by p53. Mol Cell 2001;7:683–94.[CrossRef][Medline]
  6. Yu J, Zhang L, Hwang PM, Kinzler KW, Vogelstein B. PUMA induces the rapid apoptosis of colorectal cancer cells. Mol Cell 2001;7:673–82.[CrossRef][Medline]
  7. Sax JK, Fei P, Murphy ME, et al. BID regulation by p53 contributes to chemosensitivity. Nat Cell Biol 2002;4:842–9.[CrossRef][Medline]
  8. Vousden KH, Lu X. Live or let die: the cell's response to p53. Nat Rev Cancer 2002;2:594–604.[CrossRef][Medline]
  9. Marchenko ND, Zaika A, Moll UM. Death signal-induced localization of p53 protein to mitochondria. A potential role in apoptotic signaling. J Biol Chem 2000;275:16202–12.[Abstract/Free Full Text]
  10. Sansome C, Zaika A, Marchenko ND, Moll UM. Hypoxia death stimulus induces translocation of p53 protein to mitochondria. Detection by immunofluorescence on whole cells. FEBS Lett 2001;488:110–5.[CrossRef][Medline]
  11. Erster S, Mihara M, Kim RH, Petrenko O, Moll UM. In vivo mitochondrial p53 translocation triggers a rapid first wave of cell death in response to DNA damage that can precede p53 target gene activation. Mol Cell Biol 2004;24:6728–41.[Abstract/Free Full Text]
  12. Dumont P, Leu JI, Della Pietra AC III, George DL, Murphy M. The codon 72 polymorphic variants of p53 have markedly different apoptotic potential. Nat Genet 2003;33:357–65.[CrossRef][Medline]
  13. Gonzalez-Garcia M, Perez-Ballestero R, Ding L, et al. bcl-XL is the major bcl-x mRNA form expressed during murine development and its product localizes to mitochondria. Development 1994;120:3033–42.[Abstract]
  14. Kaufmann T, Schlipf S, Sanz J, Neubert K, Stein R, Borner C. Characterization of the signal that directs Bcl-x(L), but not Bcl-2, to the mitochondrial outer membrane. J Cell Biol 2003;160:53–64.[Abstract/Free Full Text]
  15. Boise LH, Gonzalez-Garcia M, Postema CE, et al. bcl-x, a bcl-2-related gene that functions as a dominant regulator of apoptotic cell death. Cell 1993;74:597–608.[CrossRef][Medline]
  16. Lindenboim L, Borner C, Stein R. Bcl-x(S) can form homodimers and heterodimers and its apoptotic activity requires localization of Bcl-x(S) to the mitochondria and its BH3 and loop domains. Cell Death Differ 2001;8:933–42.[CrossRef][Medline]
  17. Vander Heiden MG, Chandel NS, Williamson EK, Schumacker PT, Thompson CB. Bcl-xL regulates the membrane potential and volume homeostasis of mitochondria. Cell 1997;91:627–37.[CrossRef][Medline]
  18. Harris AW, Pinkert CA, Crawford M, Langdon WY, Brinter RL, Adams JM. The Em myc transgenic mouse. A model for high-incidence spontaneous lymphoma and leukemia of early B cells. J Exp Med 1988;167:353–71.[Abstract/Free Full Text]
  19. Schmitt CA, McCurrach ME, de Stanchina E, Wallace-Brodeur RR, Lowe SW. INK4a/ARF mutations accelerate lymphomagenesis and promote chemoresistance by disabling p53. Genes Dev 1999;13:2670–7.[Abstract/Free Full Text]
  20. Schmitt CA, Rosenthal CT, Lowe SW. Genetic analysis of chemoresistance in primary murine lymphomas. Nat Med 2000;6:1029–35.[CrossRef][Medline]
  21. Jacobs JJ, Scheijen B, Voncken JW, Kieboom K, Berns A, van Lohuizen M. Bmi-1 collaborates with c-Myc in tumorigenesis by inhibiting c-Myc-induced apoptosis via INK4a/ARF. Genes Dev 1999;13:2678–90.[Abstract/Free Full Text]
  22. Eischen CM, Roussel MF, Korsmeyer SJ, Cleveland JL. Bax loss impairs Myc-induced apoptosis and circumvents the selection of p53 mutations during Myc-mediated lymphomagenesis. Mol Cell Biol 2001;21:7653–62.[Abstract/Free Full Text]
  23. Eischen CM, Woo D, Roussel MF, Cleveland JL. Apoptosis triggered by Myc-induced suppression of Bcl-X(L) or Bcl-2 is bypassed during lymphomagenesis. Mol Cell Biol 2001;21:5063–70.[Abstract/Free Full Text]
  24. Eischen CM, Weber JD, Roussel MF, Sherr CJ, Cleveland JL. Disruption of the ARF-Mdm2-p53 tumor suppressor pathway in Myc-induced lymphomagenesis. Genes Dev 1999;13:2658–69.[Abstract/Free Full Text]
  25. Luo JL, Yang Q, Tong WM, Hergenhahn M, Wang ZQ, Hollstein M. Knock-in mice with a chimeric human/murine p53 gene develop normally and show wild-type p53 responses to DNA damaging agents: a new biomedical research tool. Oncogene 2001;20:320–8.[CrossRef][Medline]
  26. Bossi G, Mazzaro G, Porrello A, Crescenzi M, Soddu S, Sacchi A. Wild-type p53 gene transfer is not detrimental to normal cells in vivo: implications for tumor gene therapy. Oncogene 2004;23:418–25.[CrossRef][Medline]
  27. Foster BA, Coffey HA, Morin MJ, Rastinejad F. Pharmacological rescue of mutant p53 conformation and function. Science 1999;286:2507–10.[Abstract/Free Full Text]
  28. Bykov VJ, Issaeva N, Shilov A, et al. Restoration of the tumor suppressor function to mutant p53 by a low-molecular-weight compound. Nat Med 2002;8:282–8.[CrossRef][Medline]
  29. Moll U. New p53-based strategies for cancer therapy. Natick (MA): Eaton Publishing; 2000. p. 439–55.
  30. Herman JG, Baylin SB. Gene silencing in cancer in association with promoter hypermethylation. N Engl J Med 2003;349:2042–54.[Free Full Text]
  31. Chao C, Saito S, Anderson CW, Appella E, Xu Y. Phosphorylation of murine p53 at Ser-18 regulates the p53 responses to DNA damage. Proc Natl Acad Sci U S A 2000;97:11936–41.[Abstract/Free Full Text]
  32. Bruins W, Zwart E, Attardi LD, et al. Increased sensitivity to UV radiation in mice with a p53 point mutation at Ser389. Mol Cell Biol 2004;24:8884–94.[Abstract/Free Full Text]
  33. Johnson TM, Hammond EM, Giaccia A, Attardi LD. The p53QS transactivation-deficient mutant shows stress-specific apoptotic activity and induces embryonic lethality. Nat Genet 2005;37:145–52.[CrossRef][Medline]
  34. MacPherson D, Kim J, Kim T, et al. Defective apoptosis and B-cell lymphomas in mice with p53 point mutation at Ser 23. EMBO J 2004;23:3689–99.[CrossRef][Medline]
  35. Sluss HK, Armata H, Gallant J, Jones SN. Phosphorylation of serine 18 regulates distinct p53 functions in mice. Mol Cell Biol 2004;24:976–84.[Abstract/Free Full Text]
  36. Concin N, Becker K, Slade N, et al. Transdominant {Delta}TAp73 isoforms are frequently up-regulated in ovarian cancer. Evidence for their role as epigenetic p53 inhibitors in vivo. Cancer Res 2004;64:2449–60.[Abstract/Free Full Text]
  37. Moll UM, Erster S, Zaika A. p53, p63 and p73—solos, alliances and feuds among family members. Biochim Biophys Acta 2001;1552:47–59.[Medline]
  38. Schuler M, Green DR. Mechanisms of p53-dependent apoptosis. Biochem Soc Trans 2001;29:684–8.[CrossRef][Medline]
  39. Jacobson MD, Burne JF, Raff MC. Programmed cell death and Bcl-2 protection in the absence of a nucleus. EMBO J 1994;13:1899–910.[Medline]
  40. Martin SJ, Finucane DM, Amarante-Mendes GP, O'Brien GA, Green DR. Phosphatidylserine externalization during CD95-induced apoptosis of cells and cytoplasts requires ICE/CED-3 protease activity. J Biol Chem 1996;271:28753–6.[Abstract/Free Full Text]
  41. Schulze-Osthoff K, Walczak H, Droge W, Krammer PH. Cell nucleus and DNA fragmentation are not required for apoptosis. J Cell Biol 1994;127:15–20.[Abstract/Free Full Text]
  42. Mihara M, Moll UM. Detection of mitochondrial localization of p53. Methods Mol Biol 2003;234:203–9.[Medline]
  43. Chipuk JE, Kuwana T, Bouchier-Hayes L, et al. Direct activation of Bax by p53 mediates mitochondrial membrane permeabilization and apoptosis. Science 2004;303:1010–4.[Abstract/Free Full Text]
  44. Petros AM, Gunasekera A, Xu N, Olejniczak ET, Fesik SW. Defining the p53 DNA-binding domain/Bxl-xL binding interface using NMR. FEBS Lett 2004;28073:1–4.
  45. Leu JI, Dumont P, Hafey M, Murphy ME, George DL. Mitochondrial p53 activates Bak and causes disruption of a Bak-Mcl1 complex. Nat Cell Biol 2004;6:443–50.[CrossRef][Medline]



This article has been cited by other articles:


Home page
J. Biol. Chem.Home page
E. C. Pietsch, E. Perchiniak, A. A. Canutescu, G. Wang, R. L. Dunbrack, and M. E. Murphy
Oligomerization of BAK by p53 Utilizes Conserved Residues of the p53 DNA Binding Domain
J. Biol. Chem., July 25, 2008; 283(30): 21294 - 21304.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Supplementary Data
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Talos, F.
Right arrow Articles by Moll, U. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Talos, F.
Right arrow Articles by Moll, U. M.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online