| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
Immunology |
Departments of 1 Immunology and 2 Pediatrics, Roswell Park Cancer Institute, Buffalo, New York; 3 Faculty of Chemistry, Warsaw University, Warszawa, Poland; and 4 Faculty of Biotechnology, Jagiellonian University, Kraków, Poland
Requests for reprints: Danuta Kozbor, Department of Immunology, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263. Phone: 215-355-4549; Fax: 716-845-8906; E-mail: danuta.kozbor{at}roswellpark.org.
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
Currently, the GD2 lactone-keyhole limpet hemocyanin (KLH) conjugate vaccine shows promise for active, specific immunotherapy in patients with malignant melanoma (18). However, the potential difficulty associated with this immunization approach resides in the induction of relatively low levels of GD2-specific immunoglobulin G (IgG) antibody responses (18), raising the possibility that the GD2 conjugate may not be sufficiently immunogenic in immunosuppressed individuals (reviewed in ref. 19). It is also probable that the carrier protein, due to a highly cross-reactive nature and strong immunogenicity, can act as a polyclonal activator causing suppression of protective immune responses. For example, immunization of mice with a glycoconjugate vaccine composed of the glucuronoxylomannan (GXM) component of the cryptococcal capsular polysaccharide conjugated to tetanus toxoid produced antibodies that were both protective and nonprotective (20). Similarly, peptide mimetics of GXM did not elicit a strong immune response to GXM when they were conjugated to KLH. Rather, KLH contained carbohydrate antigens that elicited an anti-GXM response to nonprotective epitopes (20). Because nonprotective antibodies block the efficacy of protective humoral responses, an effective vaccination strategy must focus on the induction of antibody responses to a protective epitope (2022).
In a search for a method of generating a vaccine to GD2 ganglioside that is T-cell dependent, highly immunogenic, and specifically directs the antibody response to a protective epitope, we have focused on the GD2 mimetic peptides as surrogate antigens. Mimetic peptides represent a very promising tool to overcome T-cell independence of some carbohydrate antigens (23) and offer an attractive alternative to glycoconjugates (18) or anti-idiotypic antibodies (2426). The chemical composition and purity of synthesized peptides can be precisely defined, and immunogenicity significantly enhanced, by polymerization. Peptide synthesis may be more practical than synthesis of carbohydrate-protein conjugates or production of anti-idiotypes. Furthermore, mimetic peptides can also provide immunologic memory for a carbohydrate boost (27) and can be engineered into plasmids for DNA vaccination to increase the level and persistence of carbohydrate-specific immune responses (28).
In these studies, we investigated whether interconversion of GD2 ganglioside into a peptide mimetic form would induce GD2-specific IgG antibody responses by DNA vaccination in mice. Screening of the X15 phage display peptide library with GD2-specific 14G2a mAb, followed by molecular modeling and mutagenesis studies, led to identification of the GD2 mimetic peptide 47-LDA. Immunization of BALB/c mice with peptide 47-LDAencoded plasmid DNA elicited GD2 cross-reactive IgG antibody responses, which were enhanced on subsequent boost with GD2 ganglioside. The vaccine-induced GD2-specific antibodies were capable of complement-dependent cytotoxicity and induced protection against s.c. growth of human GD2-positive MV3 melanoma cells in severe combined immunodeficient (SCID) mice. This information contributes to our understanding of the structural mimicry of antigenic determinants defined by 14G2a mAb on the GD2 mimetic peptide as well as the effectiveness of this vaccination approach in immunotherapy against GD2-positive tumor cells.
| Materials and Methods |
|---|
|
|
|---|
Antibodies. The anti-GD2 mAb 14G2a was purified from culture supernatant by affinity chromatography on the HiTrap Protein G HP column (Amersham Pharmacia Biotech, Piscataway, NJ). Horseradish peroxidase (HRP)conjugated anti-M13 mAb was purchased from Amersham Pharmacia Biotech. HRP- and alkaline phosphataseconjugated goat anti-mouse IgG and IgM antibodies as well as HRP-conjugated rabbit anti-human Ig were purchased from Sigma (St. Louis, MO). FITC-conjugated F(ab')2 fragment of goat anti-mouse Ig was purchased from ICN Biomedicals, Inc. (Costa Mesa, CA). The alkaline phosphataseconjugated rat anti-mouse IgG1, IgG2a, IgG2b, or IgG3 antibodies were purchased from BD PharMingen (San Diego, CA).
Serum specimens from patients with neuroblastoma. Serum specimens were prepared from peripheral blood obtained from five patients who were diagnosed with neuroblastoma at Roswell Park Cancer Institute. Patients 12 and 41 had progressed and metastasized tumor at the time of blood sample collection. Patient 23 was diagnosed with stage IV neuroblastoma and remained in remission for many years after bone marrow transplantation. This patient was in relapse at the time of sample collection. Patients 35 and 50 were at stage I neuroblastoma and remained in remission for many years. Our investigation had prior approval of the Institutional Review Board on human experimentation.
Isolation of mimetic peptides from the X15 peptide library. The phage display peptide library X15 used for panning with 14G2a mAb was kindly provided by Dr. J.K. Scott (Simon Fraser University, Burnaby, British Columbia, Canada). The library displayed 15-amino-acid, random, linear peptide inserts at the N terminus of the synthetic pVIII major coat protein of bacteriophage vector f88.4 (34). Panning of the amplified peptide library X15 with 14G2a was done as described (35). The reactivity of random phage clones with 14G2a mAb was done by the immunoscreening assay as described (35). The nucleotide sequence of peptide inserts was determined by the dideoxynucleotide chain termination method (36) using the M13 primer (5'-AGTAGCAGAAGCCTGAAGA-3') in the Biopolymer Facility at Roswell Park Cancer Institute.
Synthetic peptides. The amino acid sequence of the synthetic peptides isolated from the X15 phage display peptide library is shown in Table 1. All peptides were synthesized and characterized in the Molecular Genetics Instrumentation Facility at the University of Georgia (Athens, GA).
|
-chain (amino acids 1-113: DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELK) and the VH chain (amino acids 114-228: EVQLLQSGPELEKPSASVMISCKASGSSFTGYNMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRATLTVDKSSSTAYMHLKSLTSEDSVYYCVSGMEYWGQGTSVTVSS) was provided by Dr. Stephen Gillies (EMD Pharmaceuticals, Billerica, MA). The template structure of the VH and VL domains was identified by the PSI-BLAST program (37) using the PDB code 1jp5 (38, 39). After three PSI-BLAST iterations, a sequence-to-structure alignment of the model sequence and template structure was generated. The alignment was subsequently used in the antibody model building with an automated molecular modeling program, MODELLER v.6.2 (40). The resulting model was refined by the molecular minimization procedure that employed the AMBER force field (41). Then, an initial structure of the peptide was built using the Biodesigner molecular modeling program (http://www.pirx.com/biodesigner/index.shtml). Subsequently, the structure of the peptide was oriented by hand close to the putative antibody-combining site (using the Biodesigner program) and the entire system was modeled using a lattice Monte Carlo simulation algorithm (42). The lowest energy conformation was selected as a final model with three united atoms per residue that corresponded to the
carbon, ß carbon, and the center of the remaining portion of the side chain (where applicable). These united atoms were the centers of interactions in the model force field, which consisted of a set of knowledge based potentials derived from a statistical analysis of structural regularities seen in proteins and polypeptides (37). The CABS (CA-ß carbon-Side group) molecular modeling tool (37) was employed, and the full-atom model reconstruction step was carried out using PULCHRA (43). The final molecular model of the 14G2a V region and the peptide was refined using the AMBER force field. Alanine-scanning mutagenesis. Individual substitution of amino acids in the GD2 mimetic peptide 47 with Ala was carried out by a site-directed mutagenesis using the phage clone 47 with specific oligonucleotide primers and a reagent kit from Stratagene (La Jolla, Ca) according to the protocol of the manufacturer.
Construction of the 47-LDA expression vector. The human codon-optimized oligonucleotide, corresponding to the GD2 mimetic peptide 47-LDA (EDPSHSLGLDAALFM) and two universal T helper (Th) peptides PADRE (AKFVAAWTLKAAA; ref. 44) and P18MN (CKRKIHIGPGQAFYT; ref. 45), was generated using four 60-mer primers with 15-nucleotide overlaps by a PCR amplification method. Oligonucleotides corresponding to the spacer sequence KCKRQC and the Th epitopes were inserted upstream of the 47-LDA peptide sequence. To avoid the generation of junctional epitopes, an oligonucleotide linker corresponding to the GPGPG sequence was inserted between PADRE, P18MN, and 47-LDA. The entire 47-LDA construct was synthesized with upstream (5'-AAAGCGGCCGCCAAGTGCAAGCGCCAG-3') and downstream (5'-GCCGGGGATCCCTCAGCCCTTAGGCAT-3') primers containing the NotI and BamHI restriction enzyme cleavage sequences, respectively. The final PCR product was purified and cloned into NotI and BamHI sites of the pNGVL-7 vector (University of Michigan, Ann Arbor, MI) by fusing the 47-LDA polytope open reading frame with tissue plasminogen activator secretory signal sequence (tPA) under the control of human cytomegalovirus immediate early promoter.
Flow cytometry analysis and immunoblotting. Transient transfection of 293 T cells was done with the 47-LDA construct or sham vector using Lipofectamine Reagent (Invitrogen, Carlsbad, CA) according to the protocol of the manufacturer. The intracellular staining of the transfected cells was carried out using 14G2a mAb and BD Cytofix/Cytoperm kit (PharMingen) according to the protocol of the manufacturer. Culture supernatants from the transfected cells were concentrated 10-fold on Centriplus YM-3 filters (Amicon, Bedford, MA), separated by SDS-12% PAGE, and analyzed by immunoblotting with 14G2a mAb using enhanced chemiluminescence Western blotting detection reagent (Amersham Pharmacia Biotech) according to the protocol of the manufacturer.
Immunization. Six-week-old BALB/c mice (n = 5 per group) were injected i.m. in the quadriceps with 100 µg of plasmid encoding the 47-LDA construct or sham vector on days 0, 21, and 42. For the GD2 boost, the minigene- or sham vectorimmunized mice were injected i.p. with 40 µg of GD2 (Voigt Global Distribution LLC, Kansas City, MO) emulsified in incomplete Freund's adjuvant (Sigma) 3 weeks after DNA immunization. Sera were collected 3 weeks after the last immunization and analyzed for GD2-specific antibody responses.
Measurements of anti-GD2 antibody titers and isotypes. The level of GD2 cross-reactive antibodies was determined by testing serial 3-fold dilutions of sera from the immunized mice by ELISA with GD2-coated wells as described elsewhere (46). Subisotyping of serum IgG antibody responses was carried out with alkaline phosphataseconjugated rat anti-mouse IgG1, IgG2a, IgG2b, or IgG3 secondary antibodies (BD PharMingen). Sample dilutions were considered positive if the absorbance recorded for that dilution was significantly different from the absorbance recorded for the control sera from mice immunized with the sham vector using paired Student's t test (P < 0.05). As positive controls, GD2-specific 126 (IgM) and 14G2a (IgG2a) mAbs were included in the assay. The vaccine-induced GD2 cross-reactive IgG antibody responses were quantified from a standard curve generated concurrently using GD2-specific 14G2a mAb.
Antibody inhibition assays. For the inhibition assay, varying amounts of synthetic peptides or soluble GD2 ganglioside were mixed with 14G2a mAb or the vaccine-induced antibodies used at a concentration of 1 µg/mL. Following an overnight incubation at 4°C, the mixtures were added to IMR-32 cells and the inhibition was determined by immunofluorescence staining and flow cytometry analysis. In some experiments, ELISA assay was used to determine the ability of soluble GD2 ganglioside to inhibit the antibody binding to GD2-coated wells.
Complement-dependent cytotoxicity assay. The complement-mediated lysis of tumor cells was assayed at serum dilutions of 1:30 and 1:100 with 51Cr-labeled IMR-32 and HT-144 cells, and the rabbit complement (Cedarlane Laboratories, Ltd., Hornby, Ontario, Canada) as previously described (47). The percent of specific lysis was calculated as [(cpm experimental release cpm spontaneous release) / (cpm maximum release cpm spontaneous release)] x 100.
The severe combined immunodeficient mouse xenograft tumor challenge and antitumor therapy. Groups of five female SCID mice were injected s.c. in the lateral flank with 106 human MV3 melanoma cells. Tumor growth was monitored by measuring s.c. tumors once to thrice a week with a microcaliper and determining tumor volume (width x length x width / 2 = mm3). Mice injected with the s.c. tumors were treated, beginning on day 3 after tumor challenge, for 7 consecutive days with 5 µg of GD2 cross-reactive antibody per day (7 days x 5 µg/d) by 100-µL tail vein injections. Then, the antibodies were administered every 3 days for a 2-week period. In parallel, control mice that were inoculated with MV3 tumor were treated with 5 µg/d of murine IgG. The GD2-specific antibodies were purified from pooled sera of 47-LDA minigene and GD2-immunized BALB/c mice using the HiTrap Protein G HP column (Amersham Pharmacia Biotech) according to the protocol of the manufacturer. The concentration of GD2-specific IgG antibodies was quantified by GD2-specific ELISA from a standard curve generated concurrently using GD2-reactive 14G2a mAb.
Statistical analysis. The statistical significance of the difference between groups presented in Figs. 1 and 4A was done using a two-tailed Student's t test assuming equal variance. In Table 2, mixed model ANOVAs (48) were used to compare mean values of GD2-specific antibody responses between mice immunized with the 47-LDA minigene or sham vector vaccine alone or in combination with GD2 booster immunization. In Fig. 4B and C, the P values for the pairwise group comparisons for the average tumor growth over days 20 to 46 were computed using the nonparametric Wilcoxon's rank-sum test. Data were presented as arithmetic mean ± SD and analyzed using the JMP program (SAS Institute, Inc., Cary, NC) on a Windows-based platform.
|
|
|
| Results |
|---|
|
|
|---|
Recognition of the GD2 mimetic peptides by anti-GD2 serum antibodies from patients with neuroblastoma. To further characterize similarity between the isolated peptides and GD2 ganglioside, we examined their reactivity with GD2-specific antibodies in sera from neuroblastoma-bearing patients. Because GD2-specific antibody responses occur in less than 20% of patients with GD2-positive tumors (49), GD2-specific ELISA was first used to identify the ganglioside-reactive sera. As shown in Fig. 1A, only one of five patients (patient 12) analyzed exhibited GD2-specific antibodies detectable at the serum dilution of 1:10. Subsequently, serum specimens from patient 12 were used to investigate reactivity with the isolated GD2 mimetic peptides in ELISA. Figure 1B shows that at the serum dilution of 1:10, a specific binding was measured with peptides 47, 9, and 51 (P < 0.001). Other peptides showed reactivity comparable to that obtained with the control serum of a healthy individual.
Molecular modeling of the GD2 mimetic peptide interaction with the antibody-combining site of 14G2a. To understand the structural basis for antigenicity of the GD2 mimetic peptides, we analyzed a three-dimensional structure of peptide 47 complexed with the VH14G2a and VL14G2a chains of 14G2a mAb. This peptide was selected for the study because it was the most effective in inhibiting the binding of 14G2a to cellular GD2 and reacts with GD2-specific antibodies from the neuroblastoma-bearing patient. Peptide 47 also blocked the binding of peptides 9 and 51 to 14G2a mAb (not shown), suggesting that these three peptides mimic an overlapping epitope of GD2.
The interaction of peptide 47 with the antibody-combining site of 14G2a was analyzed by the refined lowest energy molecular model using the lattice Monte Carlo simulation algorithm and the AMBER force field. This approach positioned the peptide fragment within the antibody-combining site free of steric conflicts. As shown in Fig. 2A, the computer-screening search identified 23 residues in the VH14G2a and VL14G2a chains that interacted with peptide 47. Some of them, such as His-31 of the
chain and Met-213 of the VH14G2a chain, contacted three and four residues of the peptide, respectively. The residues within the VH14G2a and VL14G2a chains that seemed to be important for the positioning peptide 47 in the antibody-combining site included Met-213 of the VH14G2a chain interacting with Asp-2, Pro-3, Ser-6, and Leu-7 as well as His-31 of the VL14G2a chain interacting with Leu-9, Asp-10, and Leu-13. Other residues, such as Asn-33, Tyr-37, Ser-96, Arg-32, Val-99, Thr-97, and Pro-101 of the VL14G2a region, contacted two or three different amino acids within the peptide motif from Leu-7 to Met-15 (LGLDVALFM). Among these amino acids, Leu-7 interacted with four residues of the VL14G2a chain and with two residues in VH14G2a domain (Fig. 2A and B). Other residues of the peptide from Leu-9 to Phe-14 interacted solely with amino acids located in the VL14G2a chain. The C-terminal Met-15 anchored the end of the peptide in a pocket formed by Val-99 and Pro-101 in the VL14G2a chain, and Ser-172 in the VH14G2a segment. On the other hand, the interaction of residues from Glu-1 to Ser-6 in the N-terminal part of the peptide was flexible and limited to a contact with one or two amino acids within the VL14G2a or VH14G2a chain.
|
Generation of the 47-LDA minigene vaccine. To investigate whether the identified GD2 mimetic peptide would induce GD2 cross-reactive IgG antibody responses, we generated a codon-optimized 47-LDA construct expressing the chimeric peptide consisting of the tPA leader sequence fused in-frame with the Th peptides PADRE and P18MN inserted upstream of the mimetic peptide 47-LDA. It was rationalized that the leader sequence would allow exogenous expression of the 47-LDA peptide, whereas the PADRE and P18MN epitopes would facilitate binding of the 47-LDA polytope to multiple, nonoverlapping MHC class II molecules of both mice and humans (46, 47).
Direct sequencing of the 47-LDA construct confirmed the presence of an uncorrupted open reading frame encoding the tPA leader sequence together with PADRE, P18MN, and 47-LDA peptides. The immunofluorescence staining of 47-LDAtransfected 293 T cells with 14G2a mAb followed by flow cytometry analysis was done 48 hours after transfection to determine the intracellular expression of the 47-LDA polytope. Figure 3A revealed a high level of 47-LDA polytope expression compared with that in cells transfected with the sham vector (Fig. 3B). The secretion of the chimeric peptide into culture supernatant from 47-LDA transfectants was confirmed by immunoblotting with 14G2a mAb. As shown in Fig. 3C, a prominent band of 6.6 kDa was detected with 14G2a mAb in culture supernatants harvested from 47-LDA transfectants. No band was present in supernatants prepared from cells transfected with the sham plasmid. Altogether, these results showed that the GD2 mimetic peptide expressed in the 47-LDA minigene retained native antigenic determinants of the synthetic peptide recognized by 14G2a mAb.
|
30-fold higher than that induced by priming with the sham vector and GD2 ganglioside boost (P = 0.009). Furthermore, the booster immunization with GD2 of the minigene-primed mice elicited over 2-fold increases in titers of GD2 cross-reactive IgG antibody responses (P = 0.03; Table 2), suggesting that priming with the 47-LDA construct generated GD2 cross-reactive antibody responses that were further expanded by a booster immunization with the nominal antigen. Subisotyping of GD2-specific IgG antibodies in animals immunized by the prime-boost strategy revealed comparable levels of IgG2a and IgG1 with the respective titers of 1:560 and 1:410 (not shown), whereas GD2-specific IgG2b and IgG3 antibody responses were at background levels. The specificity of the vaccine-induced antibody responses to GD2 was confirmed in the inhibition assay, which showed that the binding of 1 µg/mL of serum IgG to GD2-coated wells was inhibited by soluble GD2 ganglioside with IC50 of 18.2 ± 0.5 µmol/L. These results, together with those which showed that sera from mice immunized with a construct expressing only PADRE and P18MN peptides did not induce measurable anti-GD2 antibodies, indicate that the GD2-specific humoral responses in 47-LDAimmunized mice were induced solely by the GD2 mimetic peptide.
Vaccine-induced antibodies recognize cell surfaceassociated GD2 ganglioside. We next investigated whether antibodies induced by the minigene vaccine alone or in combination with the GD2 boost were capable of recognizing GD2 ganglioside expressed on the surface of tumor cells. For these experiments, IMR-32 and HT-144 cells were incubated under a saturated condition (dilution 1:50) with sera from the immunized mice followed by staining with FITC-conjugated secondary antibodies and flow cytometry analysis. As shown in Table 2, the mean fluorescence intensities of GD2-positive IMR-32 and HT-144 cells incubated with sera from 47-LDAimmunized mice were
10-fold higher than those detected with sera from the sham vectorimmunized animals (P < 0.0001). The latter group of mice exhibited some reactivity with IMR-32 and HT-144 cells after the GD2 booster immunization although the mean fluorescence intensity was lower than that obtained after 47-LDA minigene vaccine (P < 0.03). Consistent with the ELISA assay, the antibody responses induced by the prime-boost strategy with the 47-LDA construct and GD2 ganglioside exhibited over 2-fold increases in the reactivity with IMR-32 and HT-144 cells compared with those elicited by the 47-LDA vaccine. The specificity of the binding was further confirmed by inhibition assay, which showed that the reactivity of 1 µg/mL of vaccine-induced IgG antibody with IMR-32 cells was inhibited by soluble GD2 ganglioside with an estimated IC50 of 2.4 ± 0.3 µmol/L.
Cytolytic activity of the minigene-induced antibodies against GD2-positive tumor cells. The functional properties of serum antibodies induced by the 47-LDA construct alone or in combination with the GD2 booster immunization were tested in complement-dependent lysis of IMR-32 and HT-144 cells using a standard 51Cr release assay. Figure 4A shows that at dilution 1:30, sera from mice immunized with the 47-LDA construct induced
27% specific lysis of the target cells, which was significantly higher compared with less than 10% lysis mediated by sera from the control mice (P < 0.005). The booster immunization of control mice with GD2 increased the cytolytic activity of the sera against both targets (P < 0.05), presumably due to the induction of GD2 cross-reactive IgM antibody responses by the ganglioside vaccine. The highest level of specific lysis against IMR-32 and HT-144 cells was obtained in 47-LDAimmunized mice after the booster immunization with GD2, which was
5-fold increased compared with the control group (P < 0.0001). Sera from mice immunized by the 47-LDA minigene and GD2 prime-boost strategy mediated over 40% specific lysis against the GD2-expressing tumor cells, and the activity remained at a detectable level at the serum dilution of 1:100 (not shown).
Tumor regression of GD2 gangliosideexpressing human MV3 melanoma cells in severe combined immunodeficient mice after systemic anti-GD2 antibody therapy. The therapeutic efficacy of GD2 cross-reactive IgG antibodies induced in mice by the prime-boost immunization with the 47-LDA minigene and GD2 ganglioside was assessed in the s.c. human MV3 melanoma model in SCID mice. The treatment regimen was based on that established for passive immunotherapy with the hu14.18-IL-2 immunocytokine fusion protein against s.c. growth of GD2-positive murine tumor cells in syngeneic mice (50, 51), and included administration of GD2-specific or control antibodies beginning on day 3 after tumor inoculation. As shown in Fig. 4B, all mice in the control group developed palpable tumors
20 days after the challenge. Two of five mice exhibited progressive tumor growth and were sacrificed by day 40 after tumor inoculation. The three remaining tumor-bearing mice were sacrificed by day 46. In contrast, none of the SCID mice treated with GD2-specific antibody therapy exhibited tumor growth on day 20 (Fig. 4C). Three of five mice receiving the GD2 cross-reactive antibodies developed palpable tumors by day 25, and by day 40 only one mouse remained tumor free. All of the antibody-treated animals developed progressive tumors with time. However, the GD2-specific antibody therapy significantly reduced the mean rate of tumor growth compared with the control group as measured on day 25 (9.6 ± 10.2 versus 202 ± 107.5 mm3; P < 0.008) and day 40 (150 ± 106.4 versus 1,006 ± 304.4 mm3; P < 0.009). Thus, although mice did not show complete tumor resolution following the therapy with GD2-specific antibody in these particular experiments, likely reflecting the influence of MV3 tumor growth variability from experiment to experiment, there was a significant (P < 0.0001) decrease in tumor growth in the treated mice compared with the control group.
| Discussion |
|---|
|
|
|---|
The ability of the mimetic peptide to mediate GD2 cross-reactive IgG antibody responses, which could not be effectively obtained by immunization with the GD2 ganglioside vaccine, stresses the importance of peptide mimetic vaccines in cancer-bearing patients. However, to the best of our knowledge, the structural basis of the GD2 glycolipid mimicry by the isolated peptides has never been explored in the experimental setting. Such analysis would require the establishment of molecular and structural interactions between the GD2 mimetic peptide and the antibody-combining site of 14G2a antibody. In fact, the LGLDVALFM sequence stretch of peptide 47 was shown by the refined lowest energy molecular model to be essential for this interaction, suggesting that the 14G2a antibody identified this core structure as the mimic of a particular GD2 configuration. However, recognition of this structure by the GD2-specific antibody could also rely on a sequence-dependent determinant present within and around the specific sequence motif. For example, replacement of the LD residues with Ala in the LGLDVALFM sequence stretch of peptide 47 completely abolished its binding to 14G2a antibody, whereas the same mutations had a smaller effect on the binding ability of mimetic peptides 9 and 51. Further analyses of the three-dimensional structure of 14G2a in complex with additional GD2 mimetic peptides may help to establish whether this or a similar mechanism underlies the reactivity of the antibody with multiple peptide conformations, and facilitate structure-based design of alternative peptides for the use as vaccines in cancer-bearing patients.
Identification of methods for inducing strong antibody responses to GD2 ganglioside would provide means for stimulating progress toward an effective vaccine against GD2-bearing tumors. As cancer vaccines that elicit primarily long-lasting antibody responses will likely be most effective in the minimal residual disease setting, the stage when tumor cells are few and dispersed, the induction of GD2-specific antibodies by the designed peptide mimetics alone or in the prime-boost combination with GD2 ganglioside may be beneficial for the tumor-bearing host. An additional support for this observation comes from the ability of GD2-specific antibodies in serum specimens from a patient with neuroblastoma to recognize the most antigenic peptides. The latter finding suggests that the mimetic peptide bearing an internal image of the GD2 ganglioside expressed on tumor cells in vivo may be capable of inducing GD2-specific immune responses in cancer patients. This condition remains essential for a candidate GD2 mimetic peptide to fulfill its promise as an alternative vaccine against GD2-expressing tumor cells (27).
It is clearly a unique property of this heterologous prime-boost immunization regimen using the minigene vaccine plus GD2 ganglioside to induce GD2 cross-reactive antibody responses that exhibited protection against s.c. GD2-positive tumor growth in the SCID mouse xenograft model. The protective efficacy of this approach may be further enhanced along with the administration of cytokines or other costimulatory molecules. For example, previous studies have shown that a constant infusion of interleukin 2 augmented the antitumor response induced by the hu14.18-IL-2 immunocytokine in mice with experimentally induced hepatic metastases and in animals bearing localized s.c. tumors (50). The combined treatment induced prolonged tumor eradication in most animals bearing s.c. tumors and involved both natural killer cells and T cells. These findings also suggest that engineering the mimotope into a hybrid plasmid, which can also include cytotoxic T-lymphocyte epitopes from a tumor target itself, would be expected to build an effector response that could decisively improve the tumor-protective immunity evoked by the minigene vaccine. Altogether, it is anticipated that results of our studies can lead to a rational design of therapeutic vaccines that may ultimately prove effective in clinical application against GD2-expressing tumor cells.
| Acknowledgments |
|---|
The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
We thank Drs. Ralph A. Reisfeld and Stephen Gillies for the reagents, Sandra Cieslak for help in blood sample collection, Earl Timm for help with flow cytometry analysis, and Michelle Detwiler for DNA sequencing.
Received 6/25/04. Revised 12/17/04. Accepted 2/ 8/05.
| References |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
M. Gil, M. Bieniasz, A. Wierzbicki, B. J. Bambach, H. Rokita, and D. Kozbor Targeting a Mimotope Vaccine to Activating Fc{gamma} Receptors Empowers Dendritic Cells to Prime Specific CD8+ T Cell Responses in Tumor-Bearing Mice J. Immunol., November 15, 2009; 183(10): 6808 - 6818. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Wierzbicki, M. Gil, M. Ciesielski, R. A. Fenstermaker, Y. Kaneko, H. Rokita, J. T. Lau, and D. Kozbor Immunization with a Mimotope of GD2 Ganglioside Induces CD8+ T Cells That Recognize Cell Adhesion Molecules on Tumor Cells J. Immunol., November 1, 2008; 181(9): 6644 - 6653. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Fest, N. Huebener, S. Weixler, M. Bleeke, Y. Zeng, A. Strandsby, R. Volkmer-Engert, C. Landgraf, G. Gaedicke, A. B. Riemer, et al. Characterization of GD2 Peptide Mimotope DNA Vaccines Effective against Spontaneous Neuroblastoma Metastases Cancer Res., November 1, 2006; 66(21): 10567 - 10575. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. M. Uttenreuther-Fischer, J. A. Kruger, and P. Fischer Molecular Characterization of the Anti-Idiotypic Immune Response of a Relapse-Free Neuroblastoma Patient following Antibody Therapy: A Possible Vaccine against Tumors of Neuroectodermal Origin? J. Immunol., June 15, 2006; 176(12): 7775 - 7786. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Cancer Research | Clinical Cancer Research |
| Cancer Epidemiology Biomarkers & Prevention | Molecular Cancer Therapeutics |
| Molecular Cancer Research | Cancer Prevention Research |
| Cancer Prevention Journals Portal | Cancer Reviews Online |
| Annual Meeting Education Book | Meeting Abstracts Online |