Cancer Research Cancer Epigenetics  EMT and Cancer Progression and Treatment
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online

Cancer Research 66, 10466, November 1, 2006. doi: 10.1158/0008-5472.CAN-06-0352
© 2006 American Association for Cancer Research

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Supplementary Data
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Mondal, A. M.
Right arrow Articles by Chattopadhyay, P.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Mondal, A. M.
Right arrow Articles by Chattopadhyay, P.

Cell, Tumor, and Stem Cell Biology

Identification and Functional Characterization of a Novel Unspliced Transcript Variant of HIC-1 in Human Cancer Cells Exposed to Adverse Growth Conditions

Abdul Matin Mondal, Sivasamy Chinnadurai, Kamal Datta, Shyam S. Chauhan, Subrata Sinha and Parthaprasad Chattopadhyay

Department of Biochemistry, All India Institute of Medical Sciences, Ansari Nagar, New Delhi, India

Requests for reprints: Parthaprasad Chattopadhyay, Department of Biochemistry, All India Institute of Medical Sciences, Ansari Nagar, New Delhi 110029, India. Phone: 91-11-26593314; Fax: 91-11-26588641; E-mail: parthoaiims{at}hotmail.com.


    Abstract
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The wild-type p53 gene has been widely implicated in the regulation of hypermethylated in cancer-1 (HIC-1) transcription, a master growth regulatory gene with multiple promoters and, consequently, multiple alternatively spliced transcripts. We investigated the role of p53 (wild type and mutant, both endogenous and exogenous) in modulating the various HIC-1 transcripts. We discovered a novel unspliced HIC-1 transcript, identified as "f" in leukocytes and in the human cell lines U87MG (wild-type p53), U373MG (mutant p53), MCF-7 (wild-type p53), HeLa (p53 degraded by HPV18-E6 oncoprotein), and Saos-2 (p53 null). This transcript is initiated from a new transcription start site and has an intervening stop codon that would result in a possibly truncated 22-amino-acid polypeptide. When U87MG (wild-type p53) and MCF-7 cells (wild-type p53) were exposed to adverse growth conditions of serum starvation or treated with the chemotherapeutic agent cisplatin, cells underwent apoptosis and cell cycle arrest accompanied by increase in p53 and HIC-1 transcript levels. Although the increase of the HIC-1-spliced transcripts followed the increase of p53, increase in f transcript coincided with declining p53 and HIC-1 transcript and protein levels. Moreover, the levels of HIC-1 f transcript were not induced by exogenously transfected wild-type p53 in p53-mutated U373MG and p53-null Saos-2 cells, unlike the spliced transcripts that code for full-length HIC-1 protein. These findings suggest a working model wherein the status of f transcript, which is not under direct transcriptional control of wild-type p53, may influence the level of HIC-1 protein in cancer cells. (Cancer Res 2006; 66(21): 10466-77)


    Introduction
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The tumor suppressor gene HIC-1, at chromosome 17p13.3, shows reduced expression in various tumor cells. Transfection experiments have shown that its transcription is activated by p53 (1). Overexpression of HIC-1 following transfection leads to decreased cell proliferation and induction of cell death/senescence, features similar to p53 expression. Recently, it has been also shown that HIC-1 functions as an effecter gene in p53-dependent apoptosis (2). Therefore, loss of HIC-1 function may result in increased cell proliferation and tumors (1). Both epigenetic and genetic loss of HIC-1 function accentuates the role of p53 in tumorigenesis (3). HIC-1 expression is decreased by promoter hypermethylation in several tumor types (4), and loss of heterozygosity of the 17p13.3 region is seen in several tumors (5), including gliomas (6). The HIC-1 transcript has several alternatively spliced variants, which comprise a common 3'-terminal exon 2 and different 5'-terminal exons (exon 1a, exon 1b, or exon 1c) in different human and mouse tissues (7). All these transcripts encode a protein with five Kruppel-like C2H2 zinc finger motifs and an NH2-terminal BTB/POZ (Bric-a-brac Tramtrack Broad complex/Pox virus and Zinc finger) domain found in actin-binding proteins or in transcriptional regulators involved in chromatin modeling (8, 9). It is well known that splice variants express differentially in a tissue-specific manner. The biological role of various truncated proteins has been highlighted by their discovery during tumorigenesis and in different tumor cell lines (10, 11).

Reports of induction of HIC-1 transcription by overexpression of exogenously transfected p53 under a strong constitutive promoter (1) prompted us to investigate the dependence of transcription of different HIC-1 transcripts on native expression of p53 under adverse growth conditions like serum deprivation and cisplatin exposure. Serum deprivation induces p53, which is strongly linked to the observed morphologic changes, growth suppression, and apoptosis of the treated cells (12, 13). Cisplatin exposure results in p53-induced cell cycle arrest (14). We have used the glioma cell lines U87MG (wild-type p53) and U373MG (mutant p53) and three other cell lines MCF-7 (breast carcinoma; wild-type p53), HeLa (cervical carcinoma; p53 inactivated by HPV18-E6 oncoprotein), and Saos-2 (osteosarcoma; p53 null) for our studies. A stable transfectant of U87MG with dominant-negative p53 (p53dn-U87MG) was also generated using a dominant-negative p53 clone under cytomegalovirus (CMV) promoter. Additionally, transient transfections of U373MG and Saos-2 cells with wild-type p53 under the CMV promoter were also studied. We have identified a novel unspliced transcript of HIC-1 that has a reading frame suggestive of a truncated 22-amino-acid polypeptide. This transcript is not directly induced by p53, unlike the spliced transcripts of HIC-1 that code for the full-length protein. Levels of this novel transcript were in opposite phase with the levels of functional HIC-1 transcripts under adverse growth conditions, suggesting that it may have a role in the regulation of HIC-1 protein levels.


    Materials and Methods
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Cell culture and transfection. Human glioblastoma (U87MG and U373MG), MCF-7, and HeLa cell lines were procured from the American Type Culture Collection (ATCC; Rockville, MD) and were cultured in DMEM with 10% FCS in 5% CO2, as described earlier (14). Saos-2 cell line was also procured from ATCC and cultured in McCoy's 5a medium (modified) with 15% FCS in 5% CO2. A p53 dominant-negative transfectant of U87MG (p53dn-U87MG) was generated, whereas transient transfections were done for U373MG and Saos-2 cells with wild-type p53 (referred to as p53wt-U373MG and p53wt-Saos-2 cells, respectively).

For stable transfection, U87MG cells were seeded in normal medium (i.e., DMEM with 10% FCS) at about 70% confluency in 25-cm2 flask and cultured at 37°C in 5% CO2. After 24 hours, transfection was done with 2 µg of p53 dominant-negative plasmid (pCMV-p53mt135; from Clontech Laboratories, Palo Alto, CA) using TransFast Transfection Reagent (Promega, Madison, WI) as per the manufacturers' instructions, and cells were cultured in normal medium for 3 days. Culture medium was then replaced with fresh normal medium containing G418 (800 µg/mL final concentration) and continued for 3 weeks with frequent changes (every 3 days) of normal medium containing G418. For transient transfection, U373MG and Saos-2 cells were also seeded in normal medium at about 70% confluency in 25-cm2 flask and cultured at 37°C in 5% CO2. After 24 hours, transfection was done with 5 µg of p53 wild-type plasmid (pCMV-p53; Clontech Laboratories) or 5 µg of p53 dominant-negative plasmid (pCMV-p53mt135) using TransFast Transfection Reagent (Promega). For every transient transfection, cells were also cotransfected with a reporter plasmid (pCMV-EGFP; which expresses the enhanced green fluorescent protein) to see the transfection efficiency. Flasks with >30% transfection efficiency were taken for the experiments. Controls were transfected with pCMV-EGFP alone.

Growth conditions. U87MG, p53dn-U87MG (stably transfected), U373MG, MCF-7, HeLa, and Saos-2 cells were seeded in normal medium at about 30% confluency in 25-cm2 flask and cultured at 37°C in 5% CO2. After 3 days, cells were refreshed with normal medium and kept for another 24 hours, after which the medium was replaced with either normal medium, serum-free medium (DMEM with no FCS), or normal medium with 2.5 µg/mL cisplatin and cultured for 24, 48, and 72 hours. For transient transfection, U373MG and Saos-2 cells were seeded in normal medium at about 70% confluency in 25-cm2 flask and cultured at 37°C in 5% CO2. The next day, after transfecting with the appropriate plasmid(s), the cells (control U373MG, p53wt-U373MG, control Saos-2, and p53wt-Saos-2) were cultured for 24, 48, and 72 hours in normal medium to study the effects of wild-type p53 transfection on HIC-1 expression in a dominant-negative and null p53 background.

Morphology and flow cytometry. At every time point, cells were stained with propidium iodide and analyzed on flow cytometer (Epix XL, Beckman-Coulter, Fullerton, CA) as described before (15). Data were analyzed by WinMDI 2.8 software. Cells were also visualized under a phase-contrast fluorescence microscope. Each set of experiments was repeated thrice.

cDNA synthesis and real-time PCR analysis. Total RNA was isolated from normal leukocytes and cultured cells at different time points using RNAquous-4PCR Kit (Ambion, Inc., Austin, TX). Contaminating DNA was removed by DNase I (Ambion) treatment. First-strand cDNA was synthesized by random decamer using RETROscript kit (Ambion). A negative control reverse transcription reaction was also done without adding reverse transcriptase. PCR with glyceraldehyde-3-phosphate dehydrogenase (GAPDH) primers was done for all cDNA samples to check for any DNA contamination. These intron-spanning GAPDH primers were from base 4703 to 4728 (G7-F6, forward) and 5252 to 5276 (G8-R7, reverse; accession no. AY340484) and amplify a product of 381 bp from cDNA and 574 bp from genomic DNA.

Real-time reverse transcription-PCR (RT-PCR) was done using SYBR Green I in Bio-Rad i-Cycler (Bio-Rad, Hercules, CA) with specific primers (Microsynth, Balgach, Switzerland; Table 1 ) targeting the total and different HIC-1 transcripts as well as p53 transcripts and then normalized with GAPDH transcripts. PCR was done in 25 µL reaction volume containing 1x (NH4)2SO4 PCR buffer (MBI Fermentas, Hanover, MD), 1.5 mmol/L of MgCl2, 200 µmol/L deoxynucleotide triphosphates (each), 10% DMSO, 1x SYBR Green I (Bio-Rad), 1x fluorescein (Bio-Rad), 500 mmol/L of each primer, and 1 unit of Taq polymerase (MBI Fermentas). Real-time PCR conditions were as follows: first cycle, 1 minute 30 seconds at 95°C and 1 minute at 94°C; subsequent cycles, 45 seconds at 94°C, 45 seconds at 67°C, 1 minute at 72°C, and 30 seconds at 80°C (40 cycles); final cycle, 45 seconds at 94°C, 45 seconds at 67°C, and 10 minutes at 72°C. Fluorescence of the PCR products was measured at 80°C. Melting curve analysis showed that no primer-dimer was recorded at this temperature.


View this table:
[in this window]
[in a new window]
 
Table 1. Sequences of primers used in the study

 
Relative level of the target transcripts to reference transcript (GAPDH) was calculated as 2–(Ct, test – Ct, ref). For HIC-1, specific primers were used to PCR amplify the total transcript, individual splice variants, and the unspliced transcript (Fig. 1 ). A common primer pair for determining the combined amount of all the splice variants coding for the full-length protein was also used. The expected PCR product was confirmed by melt curve analysis and agarose gel (1.5%) electrophoresis. Each real-time PCR was done in triplicate and repeated thrice.


Figure 1
View larger version (42K):
[in this window]
[in a new window]
 
Figure 1. A, schematic structure of HIC-1 gene locus with different promoters and exons for various transcripts. Figure 1, promoters P0, P1, and P2 and the transcription initiation site of the novel transcript (TIS-Hf). Figure 1, unspliced transcript f that is expressed from TIS-Hf. Exon 2 is common for all the transcripts. gagag, splicing acceptor site for all the spliced transcripts. Large boxes represent the coding regions from different transcripts. Figure 1, common region coding for the Bric-a-brac Tramtrack Broad complex/ Pox virus and Zinc finger (BTB/POZ) and zinc-finger (ZF) domains of HIC-1 protein. ATG start codon is same in both exon 1b and 5' end of transcript f (Hf), but there is a premature TGA stop codon in Hf. B, schematic representation of all the forward (Figure 1) and reverse (Figure 1) primers used to target the different HIC-1 transcripts. Bold small case alphabets and numbers indicate transcript type and their corresponding exons. C, a cartoon of all the possible PCR-amplified products and their expected sizes from various HIC-1 transcripts (left) with different primer pairs (right) as used in the study.

 
5' Rapid amplification of cDNA ends and cloning. First-strand cDNA was synthesized from 2 µg of leukocyte total RNA with specific reverse primer H2-R3 using avian myeloblastosis virus reverse transcriptase (Boehringer Mannheim, Mannheim, Germany), purified using Wizard DNA Clean-Up System (Promega), and eluted in 50 µL of 10 mmol/L Tris-HCl (pH 8). The 3' end of the first-strand cDNA was then tailed with polyadenylic acid using terminal transferase (Boehringer Mannheim). PCR was done from 5 µL of dA-tailed cDNA with oligo dT-anchor primer and a nested reverse primer H2-R2 followed by a second-round PCR with anchor primer and another nested primer H2-R1 using Expand High Fidelity PCR System (Boehringer Mannheim). Second-round PCR was also done with anchor primer and primers (Hm-R5 and Hm-R6) from the region that was supposed to be spliced out. Details of primer sequences are mentioned in Table 1 and Fig. 1. The final rapid amplification of cDNA ends (RACE) products were cloned in TA vector (Promega) and sequenced in automated DNA sequencer (Applied Biosystems, Foster City, CA). PCR products were analyzed in 2.5% agarose with 0.5 µg/mL of ethidium bromide and visualized on UV-transilluminator.

Western blotting. Cells from different time points following serum starvation and cisplatin treatment were lysed in triple detergent buffer containing protease inhibitors (14). Equal amounts of protein lysate (as quantified by Bradford reagent) were electrophoresed in 10% SDS-PAGE and electroblotted on nitrocellulose membrane (Schleicher and Schuell, Keene, NH). Membrane was blocked with 4% bovine serum albumin (BSA) in TBS at 4°C for overnight. For HIC-1, primary binding was done at room temperature for 3 hours with HIC-1 antibody (raised in rabbit against the COOH-terminal, 98-amino-acid polypeptide of HIC-1, GPDGKGKLDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT) at 1:400 dilution in 4% BSA in TBS. For p53, rabbit polyclonal anti-human p53 (Santa Cruz Biotechnology, Inc., Santa Cruz, CA) at 1:1,000 dilution in 4% BSA in TBS was used for primary binding. The blot was then washed with 0.05% Tween-TBS thrice (10 minutes each) followed by TBS thrice (10 minutes each). For secondary binding, the blot was incubated with alkaline phosphatase–conjugated goat anti-rabbit antibody (Santa Cruz Biotechnology) at 1:1,000 dilution in 4% BSA in TBS for 2 hours at room temperature. The blot was then again washed as before. Developing was done using nitroblue tetrazolium/5-bromo-4-chloro-3-indolyl phosphate system (Promega), after incubating the blot in alkaline phosphatase buffer [100 mmol/L NaCl, 5 mmol/L MgCl2, 100 mmol/L Tris base (pH 9.5)] for 30 minutes.

Statistical analysis. Significance level was measured by two-tailed paired Student's t test, and P ≤ 0.05 was taken as significant.


    Results
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
A novel unspliced HIC-1 transcript variant. The existence of multiple transcript variants of HIC-1 mRNA has been confirmed by many previous reports, as has been the role of p53 in HIC-1 transcription. We, therefore, proceeded to quantify various HIC-1 transcripts in leukocytes and in glioma cell lines in a cellular background of differing p53 status (U87MG with wild-type and U373MG with a dominant-negative mutation) by RT-PCR. Figure 1A shows the HIC-1 gene locus with different exons and their coded products. Fourteen primer pairs were chosen from the various regions of the HIC-1 gene as shown in Fig. 1B and C. In all experiments, RT-PCR with GAPDH primers was used as control. PCR with GAPDH primers gave a product of 381 bp from cDNA and 574 bp from genomic DNA (Fig. 2A ). Attempts to amplify HIC-1 transcript "b" from leukocyte mRNA by RT-PCR using the primer pair H1b-F2 and H2-R4 consistently resulted in two bands of 654 bp (not reported earlier) and 330 bp (from transcript b as described; ref. 7; Fig. 2B). Sequencing confirmed that the smaller band was a spliced variant of the larger one. We named this novel unspliced transcript as transcript "f." PCR amplification using primers H1a-F3 and H2-R4 amplified all the spliced transcripts having exon 1a (i.e., transcripts "a," "c," "d", and "e"; represented as "Hs"; 384 bp; Fig. 2B).


Figure 2
View larger version (24K):
[in this window]
[in a new window]
 
Figure 2. PCR amplification for identifying the various alternative HIC-1 transcripts. A, PCR using GAPDH primers (G7-F6 and G8-R7, which span an intron of 193 bp; Table 1) from leukocyte cDNA and genomic DNA. -ve, RT-PCR without reverse transcriptase. M, DNA marker lane. B, PCR amplification from leukocyte cDNA. G, with GAPDH primers; Hf1/Hb, with primers H1b-F2 and H2-R4; Hs, with primers H1a-F3 and H2-R4. C, PCR amplification from U87MG cDNA. The Hs, Hf1, Hc1, and Hc2 are the amplicons using primer pairs as described in Fig. 1C. D, PCR amplification from U373MG cDNA with various reverse primers. The Hf1, Hf2, Hf3, and Hf4 lanes depict the PCR products using primer pairs as described in Fig. 1C. E, PCR amplification to target only the transcript f. Hf5, with primers H1b-F2 and Hm-R5; Hf6, with primers H1b-F2 and Hm-R6. F, second-round PCR in 5' RACE of leukocyte cDNA using anchor primer and reverse primer H2-R1 from exon 2 to amplify all the HIC-1 transcripts. HR1a, HR1b, and HR1f, transcript a, b, and f, respectively. G and H, 5' RACE to target only the transcript f. HR2f and HR3f, second-round PCR products using anchor primer and Hm-R6 and anchor primer and Hm-R5, respectively. For details of primers and corresponding products, see Fig. 1B and C and Table 1.

 
RT-PCR from U87MG mRNA was also done to see the splicing status and the presence of different HIC-1 transcripts, especially b (Fig. 2C). The single 457 bp band in the "Hc1" lane suggested the presence of only transcript c. On the other hand, a single 837 bp band, but no 406 bp band (supposedly from transcript d) in lane "Hc2" indicated that there was no d transcript. In lane "Hf1," only a single product of 654 bp was amplified using primer pair H1b-F2 and H2-R4, but no 330 bp band was detected. The 330 bp band was to be expected if the previously published spliced transcript b was present in the cell line. The amplified 654 bp band indicated that no splicing occurred in transcript b in U87MG, resulting in the formation of the transcript f. RT-PCR from U373MG mRNA, using different reverse primers to target the f transcript, also showed the presence of only the novel unspliced transcript (Fig. 2D). No RT-PCR product was obtained for the other reported splice variants d and e (7) from the U87MG and U373MG cell lines (data not shown), indicating the absence of these variants. To further confirm the results about the transcript f, we did RT-PCR using reverse primers from the region "Hf" that is supposed to be spliced out in the transcript b. Products of 111 bp in the "Hf5" lane and 83 bp in the "Hf6" lane (Fig. 2E) led us to conclude that only the unspliced transcript f exists in these two cell lines. The amplification of the only 654 bp product using the primer pair H1b-F2 and H2-R4 from MCF-7, HeLa, and Saos-2 cDNAs also proved the presence of only f transcript but not the b transcript in these cell lines (data not shown).

To map the 5' end of the different transcripts, 5' RACE of the leukocyte mRNA was done using reverse primers from exon 2. Three distinct amplified products were found in our RACE experiment. Two of these correlated with the sizes of previously published transcripts (a 228 bp product from transcript a and a 354 bp product from transcript b), whereas the 516 bp band supported the existence of the novel unspliced transcript f (Fig. 2F). 5' RACE (195 bp product in lane "HR2f" and 223 bp product in lane "HR3f"; Fig. 2G and H) using reverse primers from the Hf region reconfirmed the existence of the transcript f, as they also showed the absence of splicing.

Sequencing revealed that the transcriptional start site of this novel transcript f was different from the transcript b as shown by 5' RACE (Fig. 3 ). 5' RACE revealed that transcription for b, as expected, initiates from the previously reported promoter P0 of HIC-1, whereas the f transcript initiates from a "C" 164 bases downstream of b (Fig. 1A and Fig. 3). It is possible that this f is transcribed from an alternate promoter. However, this phenomenon has not been investigated further. The region 5' to the transcriptional start site has motifs characteristic of a promoter, as analyzed by a web-based promoter finder program.1 Although the transcripts b and f have the same ATG start codon, transcript f probably encodes for a 22-amino-acid long polypeptide that may be nonfunctional (accession no. DQ187313) because of the earlier stop codon.


Figure 3
View larger version (41K):
[in this window]
[in a new window]
 
Figure 3. 5' end of transcript b and transcript f of the HIC-1 gene. Uppercase letter dictates the coding sequence. {Rsh}, transcription start sites. {uparrow}, splicing sites for the transcript b. Light gray box, common ATG start codon; dark gray box, 22-amino-acid polypeptide coded from transcript f. Open box, exon 2 region. The genome sequence of HIC-1 was retrieved from National Center for Biotechnology Information Genbank (accession no. L41919).

 
Expression of different HIC-1 transcripts in cell lines with differing p53 status. As we found the novel unspliced transcript f to be the major (61%) transcript compared with the spliced one b (39%) in leukocyte mRNA, we did real-time RT-PCR to assess the differential expression of various HIC-1 transcripts in human cell lines (U87MG, U373MG, and Saos-2) with differing endogenous p53 status. We chose one primer pair (H1a-F3 and H2-R4) that amplified Hs (384 bp) common to all the spliced transcripts a, c, d, and e coding for the full-length HIC-1 protein and another primer pair (H1b-F2 and H2-R1), which detected the novel unspliced transcript f (Hf; 404 bp) coding for the truncated and possibly nonfunctional polypeptide. We also chose a primer pair (H2-F1 and H2-R4; from the common region exon-2) that could amplify all the sliced and unspliced transcripts of HIC-1 ("Ht"; 264 bp). Transcript b was not included in this study as it was not detectable in any of the cell lines we investigated.

An initial clue of the direct positive effect of p53 on the Hs transcripts but not on f transcript came from their basal levels in culture of U87MG, U373MG, and Saos-2 cell lines. A higher level of HIC-1 total transcripts (Ht) was observed in control U87MG mRNA (Supplementary Fig. S1A) compared with control U373MG (Fig. 4A ) and control Saos-2 (Fig. 4B) mRNAs. Although the levels of Ht transcripts in U373MG were less (37-fold) than in U87MG (Fig. 5B, NM 72 h ), the Hs level was relatively more reduced (398-fold) compared with the Hf level (11-fold) in the mutated p53 environment of U373MG (Fig. 6A and C, NM 72 h ). We then proceeded to create a dominant-negative p53 stably transfected U87MG cell line and measured the levels of different HIC-1 transcripts. Although there was a 4-fold reduction in Hf transcript, Hs transcript decreased by >7-fold when dominant-negative p53 was constitutively expressed in a wild-type p53 background (Supplementary Fig. S1A and B). This lack of dependence of Hf transcript on wild-type p53 expression was more evident when we transiently transfected U373MG and Saos-2 cells with wild-type p53 (p53wt-U373MG and p53wt-Saos-2, respectively) to study the direct effect of wild-type p53 on the levels of Hs and Hf, in a mutated or null p53 background. In both the cell lines, this resulted in the induction of Hs but not Hf transcript (Fig. 4A and B; Supplementary Fig. S4B). In U373MG, there was an increase in f transcript on 72 hours of culture, but this was not significantly different in p53-transfected and control cells (Fig. 4A). This increase was also observed in U373MG cells that were grown in normal medium and subcultured in an identical fashion but not subjected to transfection (data not shown). We have not explored the cause of this increase of Hf transcript further.


Figure 4
View larger version (13K):
[in this window]
[in a new window]
 
Figure 4. Expression of the different HIC-1 transcripts by real-time RT-PCR in control U373MG and p53wt-U373MG (A) and control Saos-2 and p53wt-Saos-2 (B). The primer pairs H1b-F2 and H2-R1, H1a-F3 and H2-R4, and H2-F1 and H2-R4 detect the unspliced transcript f depicted as Hf, all the known spliced variants (a, c, d, and e) depicted as Hs and the total HIC-1 transcripts depicted as Ht, respectively.

 

Figure 5
Figure 5
View larger version (25K):
[in this window]
[in a new window]
 
Figure 5. Real-time RT-PCR of p53 (P) and total HIC-1 transcripts (Ht) after serum starvation and cisplatin exposure. A, expression of p53 transcript in U87MG and U373MG cells after 0, 24, 48, and 72 hours in normal media (NM), in serum-free media (SFM), and in normal media with 2.5 µg/mL cisplatin (Cis). B, expression of Ht in U87MG, p53dn-U87MG, and U373MG cells after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin. C and D, expression of P and Ht in MCF-7 and HeLa cells after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin. E, expression of Ht in Saos-2 cells after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin.

 

Figure 6
Figure 6
View larger version (36K):
[in this window]
[in a new window]
 
Figure 6. Expression of total spliced transcripts (Hs) and the novel unspliced transcript (Hf) by real-time RT-PCR after serum starvation and cisplatin exposure. Expression levels of Hs and Hf in U87MG (A), p53dn-U87MG (B), U373MG (C), MCF-7 (D), HeLa (E), and Saos-2 (F) cells after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin.

 
p53 and total HIC-1 transcript levels under adverse growth conditions. After identification of the novel HIC-1 transcript and studying the effect of exogenously transfected p53 on the various HIC-1 transcripts, we extended our study to the relationship of p53 and the expression of the HIC-1 transcripts in different cell lines under adverse growth conditions. Serum starvation and cisplatin exposure were taken as examples of conditions that lead to the induction of endogenous p53. Real-time RT-PCR analysis showed a significant increase in p53 expression in U87MG as well as U373MG cells after 24 hours of serum starvation (Fig. 5A). p53 mRNA levels reached maximum at 48 hours and started to decline thereafter. After cisplatin exposure (2.5 µg/mL), p53 transcript levels increased significantly after 24 hours and continued to increase until 72 hours in U373MG. In U87MG cells, the increase in the level of transcript was significant at 72 hours (Fig. 5A), although not as much as in U373MG. In most cases, there was a good correlation between p53 transcript and protein levels (Fig. 5A, C, and D; Fig. 7A ; Supplementary Figs. S2A and S3A). However, in U87MG cells, p53 protein levels rose and were maximum at 24 hours and declined slightly thereafter. In the case of discrepancy between transcript and protein levels of p53, the kinetics of p53 protein induction were of greater significance for downstream events.


Figure 7
View larger version (19K):
[in this window]
[in a new window]
 
Figure 7. Western blotting for p53 and HIC-1 protein in U87MG cells. A, p53 protein after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin. U373MG and Saos-2 cell lysates were taken as a p53 positive and p53 negative control, respectively. B, HIC-1 protein after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin. Bottom, Coomassie staining shows equal loading of the corresponding protein lysates for immunoblotting.

 
In serum-starved U87MG cells, there was a sharp increase in the total HIC-1 transcript levels after 24 hours, which continued until 72 hours (Fig. 5B). Cells exposed to cisplatin in culture also showed a significant increase in HIC-1 mRNA after 48 hours. No significant increase of HIC-1 level was found in U373MG as well as in transfected p53dn-U87MG cells (Fig. 5B), indicating the importance of functional p53 in inducing the spliced HIC-1 transcripts in these situations (Fig. 6B and C). Similarly, MCF-7 cells exhibited induction of HIC-1 expression by endogenous functional p53 during serum starvation as well as on cisplatin exposure (Fig. 5C).

In HeLa cells, where p53 was degraded by HPV18-E6 oncoprotein, some increase of p53 and HIC-1 transcript levels in cisplatin exposure was observed. However, there was no significant increase of either HIC-1 or p53 transcripts under serum starvation (Fig. 5D). On the other hand, in Saos-2 cells with null p53, no significant increase of HIC-1 levels was found during serum starvation and cisplatin exposure (Fig. 5E).

In MCF-7 cells, the results were similar to U87MG cells. The HIC-1 protein levels in MCF-7 cells were in concordance with the p53 protein levels, which reached maximum after 24 hours of cisplatin exposure and serum starvation (Supplementary Fig. S2A and B). On the other hand, in HeLa cells, although serum starvation did not show any induction of p53 and HIC-1 proteins, some low level of induction of HIC-1 was found upon cisplatin exposure, which was also in concordance with the p53 protein levels (Supplementary Fig. S3A and B), possibly reflecting an excess over the p53 degraded by HPV18-E6. In Saos-2 cells, we found no detectable HIC-1 protein even in adverse growth conditions (Supplementary Fig. S4A).

Expression of different HIC-1 transcripts under adverse conditions. To see the expression of the various transcripts of HIC-1 under the same adverse growth conditions, we again analyzed the levels of Hs (representing transcripts a, c, d, and e) and Hf (transcript f) by real-time RT-PCR. The PCR primers H1b-F2 and H2-R4 could possibly amplify both the transcript b and f. As the transcript b was not detected in any of the cell lines tested using this primer pair (data not shown), the transcript amplified in this study by the PCR primers H1b-F2 and H2-R1 was only Hf. In U87MG, the Hs level increased until 48 hours after both serum starvation as well as cisplatin treatment and then declined at 72 hours (Fig. 6A) in concordance with the wild-type p53 levels. The scenario was totally different for Hf. U87MG cells, exposed to both these conditions, showed a slight initial decrease of Hf levels at 24 hours followed by a marked 65-fold increase at 72 hours (Fig. 6A). However, the full-length HIC-1 protein level had started declining by then, after reaching its maximum at 48 hours (Fig. 7B). The increase in Hf levels at the time the Hs transcript and full-length protein were declining is worth noting. On the other hand, in the stably transfected p53dn-U87MG and U373MG cells, where the endogenous p53 function was lost, we found no significant change in Hs and Hf levels (Fig. 6B and C). Like U87MG, MCF-7 cells exposed to serum starvation and cisplatin treatment showed a similar pattern of Hf transcript levels, which increase when Hs transcript and HIC-1 protein levels start declining (Fig. 6D; Supplementary Fig. S2B). The Hs levels after 48 and 72 hours of cisplatin-treated cells being not significantly different from each other but were less than that at 24 hours (Fig. 6D).

In Saos-2 cell line with null p53, there was no significant expression of HIC-1 f transcript and spliced transcripts under serum starvation and cisplatin exposure (Fig. 6F). HeLa cells have normal p53, which is however degraded by the E6 oncoprotein expressed by the integrated HPV18. Serum starvation did not induce p53 or HIC-1 mRNA or protein in HeLa cells (Fig. 5D and Fig. 6E; Supplementary Fig. S3A and B). However, cisplatin induced p53 mRNA and protein from 24 hours of exposure (Fig. 5D; Supplementary Fig. S3A). The increase in p53 protein by Western blotting indicates that increased p53 protein was able to overcome degradation by HPV18-E6, leading to a resultant increase in the HIC-1 Hs transcript and protein (Fig. 6E; Supplementary Fig. S3B). Although there is clear concordance of increase in mRNA and protein levels at 48 and 72 hours, at 24 hours, there is increase in protein without clear increase in specific mRNA levels. This could be due to several factors, which we have not investigated further, like assay sensitivity, protein stability, etc. The Hf transcript levels showed no significant increase in both Saos-2 and HeLa cells under these conditions (Fig. 6E and F).

Characteristics of the treated cells. Flow cytometric analysis of U87MG cells treated with 2.5 µg/mL cisplatin showed G2-M arrest but no significant apoptosis (Fig. 8A and B ). U373MG cells, however, showed extensive cellular apoptosis after 24 hours with a maximum at 48 hours. This was in concordance with our earlier study (14) that showed that wild-type p53 leads to cell cycle arrest rather than apoptosis under such conditions. On serum starvation, we observed significant arrest (G0-G1) as well as apoptosis in U87MG cells. U373MG cells showed no arrest and a lesser degree of apoptosis. Similarly, MCF-7 cells showed significant G0-G1 arrest as well as apoptosis in serum starvation and slight G2-M arrest but no apoptosis in cisplatin exposure (Supplementary Fig. S5A and B). On the other hand, HeLa cells showed significant G0-G1 arrest as well as apoptosis only in cisplatin exposure as we found in U373MG cells (Supplementary Fig. S6A and B). Similarly, in Saos-2 cells after cisplatin exposure, we observed a clear G0-G1 arrest and significant apoptosis, which also validated our assays (Supplementary Fig. S7A and B).


Figure 8
View larger version (38K):
[in this window]
[in a new window]
 
Figure 8. Flow cytometric analysis of U87MG and U373MG cells after serum starvation and cisplatin exposure. A, cellular apoptosis after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin. Bottom, corresponding flow cytometric histograms at 72 hours. B, cell cycle arrest after 0, 24, 48, and 72 hours in normal media, serum-free media, and cisplatin.

 
Some aspects of flow cytometry were further confirmed by microscopy, which revealed high cell death in cisplatin-exposed U373MG cells (Supplementary Fig. S8B) but not in U87MG (Supplementary Fig. S8A). However, U87MG and MCF-7 cells showed more cell death in serum-free medium (Supplementary Fig. S8C). In HeLa and Saos-2 cells, we found more cell death after cisplatin exposure compared with serum starvation (Supplementary Fig. S8D and E). The cellular characteristics indicated that our models of adverse growth conditions behaved in the expected manner.


    Discussion
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Our results show for the first time the existence of the unspliced transcript f of HIC-1 in the cells/cell lines studied by us (leukocytes, U87MG, U373MG, MCF-7, HeLa, and Saos-2 cells). This transcript codes for a truncated 22-amino-acid polypeptide that is probably nonfunctional and may be of importance in regulating HIC-1 activity. Another interesting aspect was that the previously reported spliced b transcript was found in leukocytes but not in the cell lines under study, even after the levels of total transcript had increased after 24, 48, and 72 hours of serum starvation and cisplatin treatment (data not shown). However, we have not further explored the aspects pertaining to the absence of this transcript in cell lines further.

The modulation of HIC-1 transcripts in adverse growth conditions has not been studied before, and all reports of regulation of HIC-1 by p53 are based on transfection of the p53 gene under a constitutively expressing CMV promoter. In this study, we have used two different conditions of adverse cell growth (serum starvation and exposure to the genotoxic chemotherapeutic agent cisplatin) on a battery of cell lines of varying tissue origins and p53 status. On serum starvation, the cells with wild-type p53 (U87MG and MCF-7) respond with apoptosis and some G0-G1 arrest, whereas they respond to cisplatin with primarily G2-M arrest. Cells with mutated/null/inactivated p53 (U373MG, Saos-2, and HeLa, respectively) show significantly less apoptosis on serum starvation than cells with normal p53 activity, whereas they respond to cisplatin primarily by apoptosis. This is shown by the flow cytometry data provided.

It is well established that HIC-1 transcription is induced by p53 transcribed from a transfected vector under a strong constitutive promoter (1). We have shown for the first time that the increase of total HIC-1 transcript, as well as that of the spliced transcripts, follows that of p53 levels in cells where an endogenous wild-type p53 locus (U87MG and MCF-7) is transcribed in a regulated manner. This is true for both serum starvation and cisplatin exposure. In cisplatin-treated U87MG cells, where there is a discrepancy between p53 mRNA and protein levels, the kinetics of HIC-1 spliced transcripts and protein match better with p53 protein. p53 protein level peaks at about 24 hours at 2.5 µg/mL of cisplatin exposure (data not shown and also previously reported; ref. 14), possibly as a result of protein stabilization, reduced ubiquitination, and proteasome-mediated degradation (16, 17). This explains the earlier induction of the HIC-1 transcript at 48 hours before p53 transcript itself increases in 72 hours. In HeLa cells, cisplatin exposure resulted in increased expression of p53, thus overcoming the HPV18-E6 protein–mediated degradation and leading to HIC-1 overexpression, whereas p53 induction was not enough under serum-free condition. The Hs levels, which represented all the spliced transcripts encoding for the full-length HIC-1 protein, correlated well with the HIC-1 protein levels in U87MG (Fig. 6A and Fig. 7B) as well as in MCF-7 cells (Fig. 6D; Supplementary Fig. S2B), which also peaked at 48 and 24 hours, respectively. This corresponds to the time at which the cellular response, in terms of cell cycle arrest and apoptosis, was marked. This indicates the involvement of HIC-1 in the downstream actions of p53, during cell cycle arrest and apoptosis, because functional/full-length HIC-1 levels directly correlate with cell fate during serum starvation and cisplatin exposure, in cells with functional p53, as has been reported by others (2).

The differential response of the unspliced transcript f with respect to the group of spliced transcripts coding for the full-length protein is another novel observation. Although the spliced transcripts increased directly in a p53-dependent manner, the same was not true for the unspliced variant. The clues to the function of f lie in its modulation during adverse growth conditions of cells having normal p53 (U87MG and MCF-7). Its kinetics is in opposite phase with the spliced transcripts. The f transcript started increasing after 48 hours (U87MG) and 24 hours (MCF-7) of both serum starvation and cisplatin exposure and was highest at 72 hours for the time points studied (Fig. 6A and D). By this time, the p53 protein (Fig. 7A; Supplementary Fig. S2A), levels of the HIC-1 spliced transcripts Hs (Fig. 6A and D) and the full-length HIC-1 protein levels (Fig. 7B; Supplementary Fig. S2B) have started to decline. This indicates the absence of a direct transcriptional induction by p53 for the f transcript (unlike the Hs transcript). The inverse correlation with the full-length protein also points to a role of f in the regulation of HIC-1 protein levels. At this stage, it was not technically feasible to elucidate the exact mechanism by which the f transcript regulates HIC-1 protein levels. We also feel that the heterologous promoter is unlikely to respond to the regulators of HIC-1 transcription and splicing. Hence, we have not experimentally addressed the mechanistic effect of Hf on Ht levels. Thus, we can only speculate that either the Hf 22-amino-acid peptide or the Hf transcript itself is responsible for the down-regulation of the spliced Hs transcripts and perhaps the HIC-1 protein.

Our initial indirect evidence of this phenomenon came from U87MG and U373MG cells where, under normal conditions, the levels of the spliced transcripts was much higher (398-fold) in U87MG compared with U373MG, whereas that for the f transcript the increase was only 11-fold. U87MG cells stably transfected with dominant-negative p53 under a strong constitutive promoter showed a 4-fold and 7-fold decrease in the Hf and Hs transcripts, respectively, during continuous culture (Supplementary Fig. S1). This phenomenon of a reduced decrease in Hf levels in these cells as well as the difference in the resting levels of HIC-1 Hs and Hf transcripts in U87MG and U373MG cells led us to investigate the phenomenon further by other transient transfection experiments. In U373MG cells, transient transfection by wild-type p53 under a strong constitutive promoter significantly induced only the spliced transcripts of HIC-1, which plateaued after 48 hours. However, the f transcript was not induced (Fig. 4A). Similarly, transient transfection of Saos-2 cells by wild-type p53 plasmid resulted in significant increase of only the HIC-1 spliced transcripts and the HIC-1 protein at 24 and 48 hours followed by a sharp decline at 72 hours, whereas there was no significant induction of the f transcript (Fig. 4B; Supplementary S4B). This provides us a clearer picture on the lack of direct control of the transcript f by p53. However, the mechanisms that lead to the alteration in the level of the f transcript under normal and adverse growth conditions are still not clear. This has not been investigated in the experiments in this publication. Although it may be possible to transfect the cells with a cloned unspliced Hf transcript to see the effect of overexpressed unspliced Hf transcript, it may not be possible to prevent its in situ splicing within the cell after overexpression. Moreover, overexpression of this transcript from a strong constitutive promoter may alter the dynamics of splicing of the spliced and unspliced transcripts as seen under pathophysiologic conditions of serum starvation or treatment with chemotherapeutic agents. We are, however, in the process of experimentally elucidating the biological role and mechanism of action of this transcript.

We have, thus, shown the existence of a novel unspliced f transcript, which possibly codes for a truncated fragment of the HIC-1 protein, in leukocytes and in a variety of cell lines of different tissue origins. As opposed to the spliced transcripts, coding for the full-length protein, the f transcript is not directly induced by p53. The regulation of functional protein levels by transcript variants that give rise to truncated polypeptides have been reported earlier for proteins like p73 and nicastrin (10, 11). We also propose a working hypothesis of the role of the f transcript in regulating HIC-1 levels. The up-regulation of HIC-1 spliced transcripts by p53 as well as the mechanism due to which the level of HIC-1 f transcript is inversely related to HIC-1 spliced transcripts and protein level are important for the regulation and activity of this p53-induced tumor suppressor protein, HIC-1. We are currently investigating the means by which this is brought about.


    Acknowledgments
 
Grant support: Swarnajayanti Fellowship of the Department of Science and Technology, India (S. Sinha) and Extra Mural Research grant from the Indian Council of Medical Research, India (P. Chattopadhyay).

The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked advertisement in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

We thank Satish Kumar, Rajesh Kumar, and Mathura Prasad for technical assistance.


    Footnotes
 
Note: Supplementary data for this article are available at Cancer Research Online (http://cancerres.aacrjournals.org/).

Current address for K. Datta: Warren Grant Magnuson Clinical Center, NIH, Room 4D49, Building 10, 10 Center Drive, Bethesda, MD 20892.

A. Matin Mondal and S. Chinnadurai were recipients of Senior Research Fellowships from the Indian Council of Medical Research, India.

1 http://www.fruitfly.org/seq_tools/promoter.html. Back

Received 1/27/06. Revised 8/14/06. Accepted 9/ 6/06.


    References
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

  1. Wales MM, Beil Margaret A, Deiry WE, Issa JP, Kuerbitz SJ, Baylin SB. p53 activates expression of HIC-1, a new candidate tumour suppressor gene on 17p13.3. Nat Med 1995;1:570–7.[CrossRef][Medline]
  2. Chen WY, Wang DH, Yen RC, Luo J, Gu W, Baylin SB. Tumor suppressor HIC1 directly regulates SIRT1 to modulate p53-dependent DNA-damage responses. Cell 2005;123:437–48.[CrossRef][Medline]
  3. Chen W, Cooper TK, Zahnow CA, et al. Epigenetic and genetic loss of Hic1 function accentuates the role of p53 in tumorigenesis. Cancer Cell 2004;6:387–98.[CrossRef][Medline]
  4. Narayan G, Arias-Pulido H, Koul S, et al. Frequent promoter methylation of CDH1, DAPK, RARB, and HIC1 genes in carcinoma of cervix uteri: its relationship to clinical outcome. Mol Cancer 2003;2:24.[CrossRef][Medline]
  5. Nicoll G, Crichton DN, McDowell HE, Kernohan N, Hupp TR, Thompson AM. Expression of the hypermethylated in cancer gene (HIC-1) is associated with good outcome in human breast cancer. Br J Cancer 2001;85:1878–82.[CrossRef][Medline]
  6. Chattopadhyay P, Rathore A, Mathur M, Sarkar C, Mahapatra AK, Sinha S. Loss of heterozygosity of a locus on 17p13.3, independent of p53, is associated with higher grades of astrocytic tumours. Oncogene 1997;15:871–4.[CrossRef][Medline]
  7. Pinte S, Guerardel C, Deltour-Balerdi S, Godwin AK, Leprince D. Identification of a second G-C-rich promoter conserved in the human, murine and rat tumour suppressor genes HIC1. Oncogene 2004;23:4023–31.[CrossRef][Medline]
  8. Deltour S, Guerardel C, Stehilin D, Leprince D. The carboxy-terminal end of the candidate tumour suppressor gene HIC-1 is phylogenetically conserved. Biochim Biophys Acta 1998;1443:230–2.[Medline]
  9. Deltour S, Guerardel C, Leprince D. Recruitment of SMRT/N-CoR-mSin3A-HDAC-repressing complexes is not a general mechanism for BTB/POZ transcriptional repressors: the case of HIC-1 and {gamma}FBP-B. Proc Natl Acad Sci U S A 1999;96:14831–6.[Abstract/Free Full Text]
  10. Confaloni A, Crestini A, Albani D, et al. Rat nicastrin gene: cDNA isolation, mRNA variants and expression pattern analysis. Brain Res Mol Brain Res 2005;136:12–22.[Medline]
  11. Petrenko O, Zaika A, Moll UM. DeltaNp73 facilitates cell immortalization and cooperates with oncogenic Ras in cellular transformation in vivo. Mol Cell Biol 2003;23:5540–55.[Abstract/Free Full Text]
  12. Terai S, Noma T, Kimura T, Nakazawa A, Kurokawa F, Okita K. Wild-type p53 gene-induced morphological changes and growth suppression in hepatoma cells. J Gastroenterol 1997;32:330–7.[Medline]
  13. Peng X, Maruo T, Matsuo H, Takekida S, Deguchi J. Serum deprivation-induced apoptosis in cultured porcine granulosa cells is characterized by increased expression of p53 protein, Fas antigen and Fas ligand and by decreased expression of PCNA. Endocr J 1998;45:247–53.[Medline]
  14. Datta K, Shah P, Srivastava T, Mathur SG, Chattopadhyay P, Sinha S. Sensitizing glioma cells to cisplatin by abrogating the p53 response with antisense oligonucleotides. Cancer Gene Ther 2004;11:525–31.[CrossRef][Medline]
  15. Datta K, Babbar P, Srivastava T, Sinha S, Chattopadhyay P. p53 dependent apoptosis in glioma cell lines in response to hydrogen peroxide induced oxidative stress. Int J Biochem Cell Biol 2002;34:148–57.[CrossRef][Medline]
  16. Maxwell SA, Mukhopadhyay T. Transient stabilization of p53 in non-small cell lung carcinoma cultures arrested for growth by retinoic acid. Exp Cell Res 1994;214:67–74.[CrossRef][Medline]
  17. Maki CG, Huibregtse JM, Howley PM. In vivo ubiquitination and proteasome-mediated degradation of p53. Cancer Res 1996;56:2649–54.[Abstract/Free Full Text]




This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Supplementary Data
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Mondal, A. M.
Right arrow Articles by Chattopadhyay, P.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Mondal, A. M.
Right arrow Articles by Chattopadhyay, P.


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
Cancer Research Clinical Cancer Research
Cancer Epidemiology Biomarkers & Prevention Molecular Cancer Therapeutics
Molecular Cancer Research Cancer Prevention Research
Cancer Prevention Journals Portal Cancer Reviews Online
Annual Meeting Education Book Meeting Abstracts Online