Table 2

Binding affinity of HPV16 E2-derived peptides to different HLA-DR types

SequenceHPV16 E2DR1DR2DR3DR4
FNSSHKGRINCNSNTTPIVHLKGDANTLKC271–300a22b6537>70
TPIVHLKGDANTLKCLRYRFKKHCTLYTAV286–31586820>70
LRYRFKKHCTLYTAVSSTWHWTGHNVKHKS301–33068>7010
SSTWHWTGHNVKHKSAIVTLTYDSEWQRDQ316–34565530>70
AIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMSI331–3658201015
  • a Sequence, first and last amino acid number of the peptide in the HPV16 E2 protein are indicated.

  • b Binding affinity of each peptide is expressed as the IC50 value: this is the peptide concentration (μM) at which binding of the standard fluorescence labeled peptide is reduced to 50% of its maximal value; >70 represents undetectable binding.